Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66320 134 / 1e-39 GATA GATA5 GATA transcription factor 5 (.1.2) AT4G34680 129 / 4e-38 GATA GATA3 GATA transcription factor 3 (.1.2) AT4G36240 127 / 6e-38 GATA GATA7 GATA transcription factor 7 (.1) AT3G51080 127 / 4e-37 GATA GATA6 GATA transcription factor 6 (.1) AT3G24050 122 / 1e-35 GATA GATA1 GATA transcription factor 1 (.1) AT5G25830 122 / 5e-35 GATA GATA12 GATA transcription factor 12 (.1) AT3G60530 120 / 6e-35 GATA GATA4 GATA transcription factor 4 (.1) AT4G32890 120 / 2e-34 GATA GATA9 GATA transcription factor 9 (.1) AT2G45050 116 / 3e-33 GATA GATA2 GATA transcription factor 2 (.1) AT3G54810 117 / 4e-33 GATA GATA8, BME3, BME3-ZF GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041810 [exp] 128 / 2e-38 AT5G66320 177 / 1e-54 GATA transcription factor 5 (.1.2) Lus10023684 [exp] 127 / 3e-38 AT3G24050 168 / 3e-52 GATA transcription factor 1 (.1) Lus10011762 [exp] 124 / 2e-36 AT3G24050 174 / 1e-53 GATA transcription factor 1 (.1) Lus10016092 [exp] 123 / 7e-36 AT1G08010 159 / 2e-47 GATA transcription factor 11 (.1.2) Lus10021466 [exp] 122 / 8e-36 AT1G08010 157 / 2e-46 GATA transcription factor 11 (.1.2) Lus10037398 [exp] 122 / 3e-35 AT1G08010 169 / 1e-50 GATA transcription factor 11 (.1.2) Lus10041313 [exp] 121 / 7e-35 AT1G08010 163 / 2e-48 GATA transcription factor 11 (.1.2) Lus10028178 [exp] 120 / 2e-34 AT2G45050 204 / 3e-65 GATA transcription factor 2 (.1) Lus10038273 [exp] 119 / 7e-34 AT4G32890 219 / 1e-69 GATA transcription factor 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G161500 [exp] 144 / 1e-43 AT5G66320 178 / 2e-53 GATA transcription factor 5 (.1.2) Potri.009G123400 [exp] 139 / 2e-41 AT5G66320 179 / 8e-54 GATA transcription factor 5 (.1.2) Potri.007G016600 [exp] 134 / 4e-39 AT3G51080 179 / 2e-53 GATA transcription factor 6 (.1) Potri.005G117600 [exp] 132 / 1e-38 AT5G66320 236 / 2e-75 GATA transcription factor 5 (.1.2) Potri.003G174800 [exp] 127 / 1e-37 AT3G24050 167 / 6e-51 GATA transcription factor 1 (.1) Potri.001G053500 [exp] 125 / 1e-36 AT3G24050 171 / 4e-52 GATA transcription factor 1 (.1) Potri.001G188500 [exp] 123 / 1e-35 AT4G32890 201 / 7e-63 GATA transcription factor 9 (.1) Potri.002G142800 [exp] 121 / 2e-35 AT3G60530 189 / 1e-59 GATA transcription factor 4 (.1) Potri.014G058600 [exp] 119 / 1e-34 AT3G60530 189 / 7e-60 GATA transcription factor 4 (.1) Potri.010G223300 [exp] 121 / 2e-34 AT3G54810 148 / 8e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10031096 pacid=23166825 polypeptide=Lus10031096 locus=Lus10031096.g ID=Lus10031096.BGIv1.0 annot-version=v1.0 ATGAAGAAGAAACAGAAGAAGAAGGAGAAGCCGACAGCGGCGGTGGGGAATTCGGATGAGGCTCTGCCGCCGGCGCAGCAGAGGAAGTGCAGCCACTGCG GGATACAGAAGACGCCGCAGTGGAGAACCGGTCCACACGGGGCTAAGACTCTCTGCAACGCATGTGGAGTCCGGTATAAGTCCGGCCGCCTGTTTCCGGA GTACAGGCCGGCAGGGAGCCCGACGTTTTCCAACGAGATGCACTCAAACAGCCACCGGAAGGTTTTGGAGATGCGGAAGAGGAAGGAGGGAGAGATGTCG GCAGCGAGTGCGGACCCGACTCCAGCTGGTCCGGGTTTCTAG
AA sequence Show only first row Show all	>Lus10031096 pacid=23166825 polypeptide=Lus10031096 locus=Lus10031096.g ID=Lus10031096.BGIv1.0 annot-version=v1.0 MKKKQKKKEKPTAAVGNSDEALPPAQQRKCSHCGIQKTPQWRTGPHGAKTLCNACGVRYKSGRLFPEYRPAGSPTFSNEMHSNSHRKVLEMRKRKEGEMS AASADPTPAGPGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66320	GATA	GATA5	GATA transcription factor 5 (....		Lus10031096 [exp]	0	1
AT3G60070			Major facilitator superfamily ...		Lus10034394 [exp]	2.0	0.7716
AT3G26600		ARO4	armadillo repeat only 4 (.1)		Lus10026695 [exp]	5.3	0.7714
AT1G13340			Regulator of Vps4 activity in ...		Lus10034303 [exp]	7.2	0.7517
AT5G58620	C3HZnF		zinc finger (CCCH-type) family...		Lus10040662 [exp]	7.3	0.7690
AT3G57450			unknown protein		Lus10019730 [exp]	9.4	0.7135
AT2G36430			Plant protein of unknown funct...		Lus10027720 [exp]	10.9	0.7340
AT5G39450			F-box family protein (.1)		Lus10037697 [exp]	11.8	0.6640
AT1G63900		DAL1	DIAP1-like protein 1, E3 Ubiqu...		Lus10008163 [exp]	12.0	0.7478
AT1G36320			unknown protein		Lus10036666 [exp]	15.0	0.6790
AT1G65910	NAC	ANAC028	NAC domain containing protein ...		Lus10010037 [exp]	15.9	0.7373

Compare expression of checked genes

Lus10031096 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.