Lus10031115 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G13820 50 / 2e-08 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT3G22580 42 / 2e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22600 40 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014681 43 / 3e-05 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10039348 40 / 0.0003 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10010572 40 / 0.0003 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G210100 43 / 2e-05 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.010G085400 39 / 0.0004 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G155100 38 / 0.001 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10031115 pacid=23151074 polypeptide=Lus10031115 locus=Lus10031115.g ID=Lus10031115.BGIv1.0 annot-version=v1.0
ATGGCTCTCTTTGCTTTTTACTTAATCGTTTTGGTTACTCACTTGAGCTCTCCTTCAGCATCTATTCCTACTGATCTACCTCCTCCTCATCTCCCTCCCG
ACGGCACGGATTGCGTCGATCCATTGTTTCGGATGGTGGCACCTTGCTTCGACTATATTGCCGTCAACACCACATTGTTGATCAGCGAGTCGAACGATTG
CTGTTCGGCATTGAAGGCCGTTTCCTCCACAAAGCCGGAGTGCTTGTGTGAGCTTTTTTACAGCTCCGGCTATGTAAACGGCGACATGGATCTTGCCAAG
GGGTTTCGGGTATTTGAAGTTTGCGGTGTTGGTTCGGGATCTCACGTCTCCGATTGCAAAGCGGAGTTGGGATTTACTACTAATACTACCGATGATGCTG
CTAAGGATGCCGGTTCTGGATCGTCGTCTTCGTCATACGTCTCAGTGCCTCTGATGGTTTCGCTTGCTGTTATCTACCTCCATTGTCACCTACCTACTGC
ATTAGTTTGA
AA sequence
>Lus10031115 pacid=23151074 polypeptide=Lus10031115 locus=Lus10031115.g ID=Lus10031115.BGIv1.0 annot-version=v1.0
MALFAFYLIVLVTHLSSPSASIPTDLPPPHLPPDGTDCVDPLFRMVAPCFDYIAVNTTLLISESNDCCSALKAVSSTKPECLCELFYSSGYVNGDMDLAK
GFRVFEVCGVGSGSHVSDCKAELGFTTNTTDDAAKDAGSGSSSSSYVSVPLMVSLAVIYLHCHLPTALV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G13820 AtXYP2 xylogen protein 2, Bifunctiona... Lus10031115 0 1
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10005537 5.8 0.9781
AT5G43120 ARM-repeat/Tetratricopeptide r... Lus10024789 6.2 0.9527
Lus10026293 11.0 0.9749
AT1G31310 Trihelix hydroxyproline-rich glycoprote... Lus10040629 12.5 0.9732
AT2G35160 SGD9, SUVH5 SET DOMAIN-CONTAINING PROTEIN ... Lus10043211 12.6 0.9748
AT3G18960 B3 AP2/B3-like transcriptional fa... Lus10012046 13.2 0.9765
AT5G01150 Protein of unknown function (D... Lus10003168 14.5 0.9737
AT1G15330 AtPV42a Cystathionine beta-synthase (C... Lus10029432 15.8 0.8695
Lus10016534 16.7 0.9723
AT5G45980 HD WOX9B, STPL, WO... WUSCHEL related homeobox 9B, S... Lus10013960 16.9 0.9729

Lus10031115 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.