Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62300 112 / 2e-33 Ribosomal protein S10p/S20e family protein (.1.2) AT3G45030 112 / 2e-33 Ribosomal protein S10p/S20e family protein (.1) AT3G47370 112 / 2e-33 Ribosomal protein S10p/S20e family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027194 [exp] 127 / 5e-39 AT5G62300 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031705 [exp] 124 / 4e-38 AT5G62300 211 / 5e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031126 [exp] 121 / 5e-37 AT3G45030 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1) Lus10038910 [exp] 121 / 6e-37 AT5G62300 210 / 8e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031706 [exp] 118 / 7e-36 AT3G45030 202 / 7e-69 Ribosomal protein S10p/S20e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G128300 [exp] 109 / 3e-32 AT5G62300 222 / 2e-76 Ribosomal protein S10p/S20e family protein (.1.2) Potri.015G129800 [exp] 109 / 5e-32 AT5G62300 223 / 9e-77 Ribosomal protein S10p/S20e family protein (.1.2) Potri.002G146600 [exp] 103 / 3e-30 AT3G47370 204 / 1e-69 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.002G116900 [exp] 96 / 9e-28 AT3G47370 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00338 [flax] [poplar] Ribosomal_S10 Ribosomal protein S10p/S20e
Representative CDS sequence Show only first row Show all	>Lus10031125 pacid=23151115 polypeptide=Lus10031125 locus=Lus10031125.g ID=Lus10031125.BGIv1.0 annot-version=v1.0 ATGTTGAGAGTTATGGGATCGGTGAGTAGGCCGACCAAGAATCTTCTTATTACCACCAGGAAGTCTCCTTGCGGTGAAGGTAATTTGCTCGACCATTTCT CGATTCGGGGAACCAACACATTCGACAGATTCGAGCTTCGTGCGCACAGGCGCGTCGTCGACCTGTTCAGCTCCCCCAAGGTGGTGAAGCAGATTACCTC GATCACGATCGAGCCCGGAGTTGAGGTCGAAGTCACAATTGCCGATGCTTACGGAACGTTTTGGGAGTTTTTCCCCATACTTGTACGCCTTGTGTTATAG
AA sequence Show only first row Show all	>Lus10031125 pacid=23151115 polypeptide=Lus10031125 locus=Lus10031125.g ID=Lus10031125.BGIv1.0 annot-version=v1.0 MLRVMGSVSRPTKNLLITTRKSPCGEGNLLDHFSIRGTNTFDRFELRAHRRVVDLFSSPKVVKQITSITIEPGVEVEVTIADAYGTFWEFFPILVRLVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10031125 [exp]	0	1
AT5G25250			SPFH/Band 7/PHB domain-contain...		Lus10001944 [exp]	5.7	0.7149
AT1G59730		ATH7	thioredoxin H-type 7 (.1)		Lus10037227 [exp]	6.0	0.6619
AT5G28210			mRNA capping enzyme family pro...		Lus10040496 [exp]	10.5	0.7147
AT5G19730			Pectin lyase-like superfamily ...		Lus10034981 [exp]	19.0	0.6748
					Lus10021453 [exp]	21.6	0.6620
AT3G45070			P-loop containing nucleoside t...		Lus10003068 [exp]	22.4	0.6822
AT4G36950		MAPKKK21	mitogen-activated protein kina...		Lus10034246 [exp]	24.2	0.6576
					Lus10016947 [exp]	27.4	0.5584
					Lus10039269 [exp]	30.0	0.5728
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Lus10034247 [exp]	30.0	0.6288

Compare expression of checked genes

Lus10031125 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.