Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47370 207 / 1e-70 Ribosomal protein S10p/S20e family protein (.1.2.3) AT5G62300 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1.2) AT3G45030 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1) AT3G13120 57 / 7e-11 Ribosomal protein S10p/S20e family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031706 [exp] 243 / 1e-84 AT3G45030 202 / 7e-69 Ribosomal protein S10p/S20e family protein (.1) Lus10031705 [exp] 227 / 2e-78 AT5G62300 211 / 5e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10038910 [exp] 218 / 1e-74 AT5G62300 210 / 8e-72 Ribosomal protein S10p/S20e family protein (.1.2) Lus10027194 [exp] 211 / 8e-72 AT5G62300 207 / 2e-70 Ribosomal protein S10p/S20e family protein (.1.2) Lus10031125 [exp] 121 / 5e-37 AT5G62300 113 / 6e-34 Ribosomal protein S10p/S20e family protein (.1.2) Lus10016604 [exp] 59 / 2e-11 AT3G13120 240 / 3e-81 Ribosomal protein S10p/S20e family protein (.1.2) Lus10007111 [exp] 57 / 2e-10 AT3G13120 226 / 3e-75 Ribosomal protein S10p/S20e family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G128300 [exp] 210 / 9e-72 AT5G62300 222 / 2e-76 Ribosomal protein S10p/S20e family protein (.1.2) Potri.015G129800 [exp] 210 / 1e-71 AT5G62300 223 / 9e-77 Ribosomal protein S10p/S20e family protein (.1.2) Potri.002G146600 [exp] 194 / 2e-65 AT3G47370 204 / 1e-69 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.002G116900 [exp] 119 / 1e-36 AT3G47370 125 / 4e-39 Ribosomal protein S10p/S20e family protein (.1.2.3) Potri.001G365600 [exp] 59 / 2e-11 AT3G13120 237 / 4e-80 Ribosomal protein S10p/S20e family protein (.1.2) Potri.011G092800 [exp] 58 / 4e-11 AT3G13120 231 / 1e-77 Ribosomal protein S10p/S20e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00338 [flax] [poplar] Ribosomal_S10 Ribosomal protein S10p/S20e
Representative CDS sequence Show only first row Show all	>Lus10031126 pacid=23150948 polypeptide=Lus10031126 locus=Lus10031126.g ID=Lus10031126.BGIv1.0 annot-version=v1.0 ATGGCGGCGGCAACTTACAAGGCACCAAAGGTCGGTCTCGAGGAGACCCAGGAGCAGATTCACAAGATCAGGATCACCCTGTCTTCCAAGAATGTGAAGA ATCTCGAGAAAGTCTGTGGTGACTTGATCCGCGGTGCTAAGGAAAAGAGGTTGAGGGTGAAAGGACCAGTCAGGATGCCTACTAAGACTCTTTTGATTAC CACCAGGAAGTCTCCCTGTGGAGAAGGTACAAACACCTTTGACAGATTCGAGCTCCGAGTACACAAGCGTGTGATCGATCTATTCAGCTCCCCAGAAGTT GTGAAGCAGATCACCTCGATCACGATCGAGCCTGGTGTCGAGGTTGAAGTCACCATTGCCGATGCTTGA
AA sequence Show only first row Show all	>Lus10031126 pacid=23150948 polypeptide=Lus10031126 locus=Lus10031126.g ID=Lus10031126.BGIv1.0 annot-version=v1.0 MAAATYKAPKVGLEETQEQIHKIRITLSSKNVKNLEKVCGDLIRGAKEKRLRVKGPVRMPTKTLLITTRKSPCGEGTNTFDRFELRVHKRVIDLFSSPEV VKQITSITIEPGVEVEVTIADA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45030			Ribosomal protein S10p/S20e fa...		Lus10031126 [exp]	0	1
AT3G45030			Ribosomal protein S10p/S20e fa...		Lus10031706 [exp]	3.5	0.8615
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10019881 [exp]	6.6	0.8383
AT1G77940			Ribosomal protein L7Ae/L30e/S1...		Lus10027926 [exp]	7.9	0.8330
AT2G31610			Ribosomal protein S3 family pr...		Lus10033442 [exp]	13.0	0.7984
AT3G10950			Zinc-binding ribosomal protein...		Lus10006414 [exp]	14.7	0.7894
AT4G02610			Aldolase-type TIM barrel famil...		Lus10018760 [exp]	15.0	0.7106
AT3G10950			Zinc-binding ribosomal protein...		Lus10011359 [exp]	15.0	0.7757
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10023825 [exp]	15.7	0.7869
AT5G28060			Ribosomal protein S24e family ...		Lus10004123 [exp]	16.0	0.7910
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10039351 [exp]	16.1	0.7399

Compare expression of checked genes

Lus10031126 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.