Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62360 135 / 4e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62760 137 / 1e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT2G01610 126 / 2e-36 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G62770 124 / 1e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT1G14890 122 / 1e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G51520 117 / 3e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G62350 113 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25250 112 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT4G25260 111 / 1e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G20740 110 / 1e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031711 [exp] 384 / 2e-138 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027198 [exp] 137 / 6e-41 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038914 [exp] 137 / 8e-41 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031713 [exp] 135 / 3e-40 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10038915 [exp] 135 / 6e-40 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10027199 [exp] 132 / 4e-39 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031133 [exp] 132 / 8e-39 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10031138 [exp] 132 / 8e-39 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10028910 [exp] 124 / 1e-35 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G128400 [exp] 181 / 3e-58 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128100 [exp] 144 / 1e-43 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128300 [exp] 144 / 1e-43 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.012G127400 [exp] 133 / 2e-39 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128200 [exp] 133 / 3e-39 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G119300 [exp] 129 / 1e-37 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128700 [exp] 126 / 9e-37 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113600 [exp] 126 / 1e-36 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G113700 [exp] 126 / 1e-36 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1) Potri.012G127500 [exp] 125 / 2e-36 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10031132 pacid=23151055 polypeptide=Lus10031132 locus=Lus10031132.g ID=Lus10031132.BGIv1.0 annot-version=v1.0 ATGGCTGGCTTTCCCTTTCTACCTATAGTGTTACTATCATTCCTCTTCTCCACAACCGTTGGATCAGGAAGCCACCAACACCATCGTCCGAATCCAACGG CAACAACCCACTACGACTTCATCAAGACATCTTGCGGGGTCACAAGGTACCCAGACCTCTGCTACTCCACGCTATCGCCTTACGCCGCCACTGTACGGAG TAACTCCACTCAGCTAGTGAACGCTGCAATCCAGGTGAGTCTAAACGACGCCGTGTCGGCTTGCAACGCAGTGCAGAACCTCTCGAAGACGTTGAAGCAG CCGAAGGAGGCTGGAGCGGTGAAGGACTGCGTGGAGAACATGAAGGATTCGATGGCTGCGATGAAAAGCGGGATGGACGGTCCTGATTTCGCCATGGAGG TCGGGAACCTGCAGACGTGGGTGAGCGCTGCGCTGACGGATGAGGACACGTGTATGGACGGGATTGAGGAAATGGAGCTGGTAAATGGGAAGGTTAAGGA TGTAATACGGGGTCGTATTGTGAGGGTTGCTCAGCTTACTAGTAATGCTCTTGCCCTTATTAATCATCTTTGTTAA
AA sequence Show only first row Show all	>Lus10031132 pacid=23151055 polypeptide=Lus10031132 locus=Lus10031132.g ID=Lus10031132.BGIv1.0 annot-version=v1.0 MAGFPFLPIVLLSFLFSTTVGSGSHQHHRPNPTATTHYDFIKTSCGVTRYPDLCYSTLSPYAATVRSNSTQLVNAAIQVSLNDAVSACNAVQNLSKTLKQ PKEAGAVKDCVENMKDSMAAMKSGMDGPDFAMEVGNLQTWVSAALTDEDTCMDGIEEMELVNGKVKDVIRGRIVRVAQLTSNALALINHLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62760			Plant invertase/pectin methyle...		Lus10031132 [exp]	0	1
AT1G06450			Polynucleotidyl transferase, r...		Lus10008043 [exp]	1.0	0.9190
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10041654 [exp]	1.4	0.9099
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Lus10021901 [exp]	1.7	0.9043
AT1G73820			Ssu72-like family protein (.1)		Lus10024545 [exp]	4.0	0.8603
AT5G04820	OFP	ATOFP13, OFP13	ARABIDOPSIS THALIANA OVATE FAM...		Lus10021303 [exp]	5.7	0.8657
AT5G20950			Glycosyl hydrolase family prot...		Lus10010657 [exp]	5.7	0.8695
AT2G27690		CYP94C1	"cytochrome P450, family 94, s...		Lus10002526 [exp]	5.9	0.8908
AT5G49170			unknown protein		Lus10024954 [exp]	6.6	0.8919
AT4G21620			glycine-rich protein (.1.2)		Lus10006730 [exp]	7.1	0.8450
AT4G14723		EPFL4, CLL2	epidermal patterning factor li...		Lus10041186 [exp]	7.2	0.8648

Compare expression of checked genes

Lus10031132 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.