Lus10031133 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62350 211 / 1e-69 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 196 / 1e-63 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 187 / 2e-60 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G12390 164 / 2e-51 PME1 pectin methylesterase inhibitor 1 (.1)
AT1G62770 162 / 1e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62360 158 / 6e-49 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 139 / 2e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 140 / 8e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 135 / 6e-40 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 127 / 5e-37 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031713 343 / 7e-122 AT5G62350 202 / 4e-66 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 226 / 5e-76 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 225 / 2e-75 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10032230 153 / 9e-47 AT1G62770 166 / 9e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 149 / 3e-45 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031138 142 / 2e-42 AT5G62360 172 / 3e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027199 142 / 2e-42 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 139 / 2e-41 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10024593 131 / 2e-38 AT1G62770 162 / 2e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G127500 244 / 5e-83 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 243 / 2e-82 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 183 / 1e-58 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.015G128200 176 / 4e-56 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128100 175 / 1e-55 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 173 / 6e-55 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128400 152 / 2e-46 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G145800 149 / 2e-45 AT4G00080 164 / 4e-51 unfertilized embryo sac 11, Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127400 147 / 1e-44 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 147 / 2e-44 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10031133 pacid=23151155 polypeptide=Lus10031133 locus=Lus10031133.g ID=Lus10031133.BGIv1.0 annot-version=v1.0
ATGGCAAACCCTAAATTTCCCCTTCTCCTAATCTCCATCCTCACCATCACCATCACCCTAGCCTCAGCATCCAACCCGGCGACATCGAGCACCGTCGCAG
CGACAAACTTCATAAAGTCCTCCTGCAGTACCACGACCTACCCAGCACTCTGCGTGCAGTCTCTCCTGTCTTACGCCCCGACCATCCAGCGCAGCCCGCG
TCAGCTGGCGCAGACTGCGTTGGCAGTAAGTCTGGCCAGGGCGCAGTCCACGAGCTCCTTCGTCAGGAAGCTGGCCAGGTTCAAGGGTCTGAGGCCCAGG
GAGGTGGCCGCCATCAAAGACTGCAAGGAAGAGATCGAGGACACAGTTGACCGGCTCAGCAAGTCGATCAAGGAGCTGAAGATGGTCGGGACGGGTGGCG
GGCCAGGGTTCGAGTGGCACGTGAGCAATGTGGTGACGTGGGTCAGCGCGGCGTTGACGAACGAGAACACGTGTGTGGACGGGTTTGGTGGGAAGGCGTT
GAATGGGAGGATGAAGGATGGGATTAGAGGGAGGTTTAGGAACACTGTTCAGGTTACTAGTAATGCTTTGGCTTTGATTAATAAGTACGCTAATAAGCAC
TGA
AA sequence
>Lus10031133 pacid=23151155 polypeptide=Lus10031133 locus=Lus10031133.g ID=Lus10031133.BGIv1.0 annot-version=v1.0
MANPKFPLLLISILTITITLASASNPATSSTVAATNFIKSSCSTTTYPALCVQSLLSYAPTIQRSPRQLAQTALAVSLARAQSTSSFVRKLARFKGLRPR
EVAAIKDCKEEIEDTVDRLSKSIKELKMVGTGGGPGFEWHVSNVVTWVSAALTNENTCVDGFGGKALNGRMKDGIRGRFRNTVQVTSNALALINKYANKH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62350 Plant invertase/pectin methyle... Lus10031133 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10007890 8.7 0.9369
AT3G15980 Coatomer, beta' subunit (.1.2.... Lus10002324 13.6 0.9208
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10005399 20.4 0.9267
AT1G17860 Kunitz family trypsin and prot... Lus10022302 25.8 0.9220
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10005358 28.8 0.9174
AT1G03495 HXXXD-type acyl-transferase fa... Lus10029826 30.0 0.8782
AT1G13090 CYP71B28 "cytochrome P450, family 71, s... Lus10002670 33.5 0.9055
AT1G17860 Kunitz family trypsin and prot... Lus10042301 40.2 0.9159
AT1G17860 Kunitz family trypsin and prot... Lus10039209 40.5 0.9055
AT1G17860 Kunitz family trypsin and prot... Lus10013770 41.8 0.9149

Lus10031133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.