Lus10031134 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25270 185 / 8e-57 OTP70 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G33990 129 / 2e-35 EMB2758 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G56310 127 / 5e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G22070 127 / 1e-34 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G37570 125 / 5e-34 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G46790 124 / 1e-33 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G40410 124 / 1e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G01030 124 / 1e-33 pentatricopeptide (PPR) repeat-containing protein (.1)
AT5G39350 124 / 2e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G71490 123 / 3e-33 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031714 258 / 1e-82 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019735 136 / 8e-38 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016387 134 / 1e-37 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016425 131 / 8e-36 AT2G22070 1002 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10031989 129 / 3e-35 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030225 125 / 5e-35 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10005987 125 / 2e-34 AT5G08510 602 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10020588 119 / 2e-33 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10002553 117 / 2e-32 AT2G22410 365 / 3e-122 SLOW GROWTH 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G128800 196 / 9e-61 AT4G25270 664 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.007G085500 130 / 7e-36 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.004G124400 129 / 2e-35 AT5G39350 785 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G097000 129 / 3e-35 AT4G01030 906 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.001G466066 126 / 3e-34 AT4G33990 1067 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.015G034900 125 / 3e-34 AT4G21065 370 / 2e-122 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.003G223900 124 / 9e-34 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G215500 124 / 2e-33 AT3G63370 922 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G243800 122 / 5e-33 AT5G59600 639 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G060600 121 / 7e-33 AT3G24000 331 / 3e-106 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10031134 pacid=23151034 polypeptide=Lus10031134 locus=Lus10031134.g ID=Lus10031134.BGIv1.0 annot-version=v1.0
ATGGTGGCCGAGAACGTGATCCCGGACAACATCACATTCGTCGCGATTCTATCTGCGTGCGCTCATCTGCGATTGGTCAAAGAAGGGGAGAGGCTGTTTT
TCGATCTGTTGAGACGGAAGTATAAAATGAGACCGATTTTGGAGCATTACGCGTGCATGGTGAATCTGTACGGGAGGGCAGGACCGGTGGAGAAAGCGTA
CGATTTCGTGATCGAGTCGATGGAGTTGGAAGCCGGGCCGACTGTGTGGGGAGCTCTGCTGCATGCTTGTTATGTGCATGGGAATGTGGAGATTGGAGAG
GTTGCTGCTCAGTGTCTGTTTGAGCTTGAACCTGATAATGAACATAATTTCGAACTTCTGGTGAAGATCTATAGCGATGTCGGGAGGGTGACGGATGCTG
AGAGGATTGTAAATGATGAACAATGTATATGGTGGCAAAGACTGAAAGGTAACCAGTTCTCGTGA
AA sequence
>Lus10031134 pacid=23151034 polypeptide=Lus10031134 locus=Lus10031134.g ID=Lus10031134.BGIv1.0 annot-version=v1.0
MVAENVIPDNITFVAILSACAHLRLVKEGERLFFDLLRRKYKMRPILEHYACMVNLYGRAGPVEKAYDFVIESMELEAGPTVWGALLHACYVHGNVEIGE
VAAQCLFELEPDNEHNFELLVKIYSDVGRVTDAERIVNDEQCIWWQRLKGNQFS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25270 OTP70 organelle transcript processin... Lus10031134 0 1
AT5G01600 ATFER1 ARABIDOPSIS THALIANA FERRETIN ... Lus10022673 2.6 0.8652
AT1G07740 Tetratricopeptide repeat (TPR)... Lus10005876 3.7 0.7974
AT5G01600 ATFER1 ARABIDOPSIS THALIANA FERRETIN ... Lus10012499 4.0 0.8457
AT5G47830 unknown protein Lus10018732 5.5 0.8111
AT2G21290 unknown protein Lus10018053 6.3 0.8054
AT5G16420 Pentatricopeptide repeat (PPR-... Lus10005989 7.4 0.7508
AT2G41080 Tetratricopeptide repeat (TPR)... Lus10003325 10.2 0.8230
AT3G23150 ETR2 ethylene response 2, Signal tr... Lus10041159 10.4 0.8290
AT3G60480 unknown protein Lus10034728 10.8 0.7740
AT3G18840 Tetratricopeptide repeat (TPR)... Lus10001445 11.3 0.7089

Lus10031134 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.