Lus10031135 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25280 263 / 7e-89 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G26667 221 / 4e-73 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT3G60180 208 / 4e-68 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT3G60961 143 / 2e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G47840 97 / 3e-24 AMK2 adenosine monophosphate kinase (.1)
AT5G35170 89 / 5e-20 adenylate kinase family protein (.1.2)
AT5G63400 79 / 2e-17 ADK1 adenylate kinase 1 (.1.2)
AT2G37250 79 / 2e-17 ADK, ATPADK1 adenosine kinase (.1)
AT2G39270 77 / 2e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G50370 74 / 7e-16 Adenylate kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031714 346 / 4e-115 AT4G25270 672 / 0.0 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031611 219 / 4e-72 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10033733 218 / 9e-71 AT5G26667 336 / 2e-117 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10019509 152 / 9e-47 AT5G26667 217 / 5e-73 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10009228 96 / 1e-23 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1)
Lus10037995 93 / 3e-23 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1)
Lus10003504 94 / 5e-23 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1)
Lus10009478 89 / 8e-22 AT5G47840 293 / 1e-101 adenosine monophosphate kinase (.1)
Lus10036326 85 / 1e-18 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G129000 278 / 3e-95 AT4G25280 301 / 6e-104 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.014G043300 224 / 1e-74 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.002G134600 221 / 5e-73 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.014G104700 208 / 4e-68 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.019G078200 94 / 1e-22 AT5G47840 332 / 8e-115 adenosine monophosphate kinase (.1)
Potri.013G103400 91 / 9e-22 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1)
Potri.018G113400 87 / 2e-19 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2)
Potri.010G215300 77 / 2e-16 AT2G37250 382 / 2e-134 adenosine kinase (.1)
Potri.008G046100 72 / 7e-15 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Potri.015G092800 69 / 5e-14 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Lus10031135 pacid=23150943 polypeptide=Lus10031135 locus=Lus10031135.g ID=Lus10031135.BGIv1.0 annot-version=v1.0
ATGAATAGCTTTGTTTTTCCGCTTGATTCTGAATCTTCCTGTTTCTGCGAGCAGCTTAGCTACGCAACTTCTTGCCTCAGAGAGAAAAATCCTTTCATCA
CTTTCGTATTAGGTGGCCCTGGGAGTGGAAAAGGAACTCAATGCGAAAGGATTGCAGCGACATTTGGTTTAACACATCTGAGCGCTGGAGATTTGCTGAG
GAAGGAAATACTAACCAACAGTAAAGAGAAGGCTACAATCCTTAACATAATCAAGGATGGCAAGATCGTCCCATCAGAGGTGACTGTCAAGCTGATCCTG
AAGGAGATGGAGTCAAGTCACAGCAACAAGTTCCTTATCGATGGGTTCCCACGAACCGAAGAGAATCGTGTGGCCTTCGAACGAATCATTGGATTAGAAC
CGAATGCTGTTCTGTTCTTCGATTGCCCAGAAGAAGAAATGGTGAAAAGGGTGCTGAACCGTAACCAGGGACGAGTCGATGACAACATAGACACATTCAA
GAAACGTTTGAAAGTGTTTGAAGCAATGAGCCTCCCTGTTGTTCACCACTACTCCAAGAAAGGAAAACTGCACAAGCTATTCAGCTCTGATGCTTTAACT
TTCCTCCGGGATTTGGCTCAGATAAAACGCGGTGGGAGACGTGGACGAAATCTTCGAACAAGCTCACGCTGTTTTCGCTTCACCAGAGATGATGATTAA
AA sequence
>Lus10031135 pacid=23150943 polypeptide=Lus10031135 locus=Lus10031135.g ID=Lus10031135.BGIv1.0 annot-version=v1.0
MNSFVFPLDSESSCFCEQLSYATSCLREKNPFITFVLGGPGSGKGTQCERIAATFGLTHLSAGDLLRKEILTNSKEKATILNIIKDGKIVPSEVTVKLIL
KEMESSHSNKFLIDGFPRTEENRVAFERIIGLEPNAVLFFDCPEEEMVKRVLNRNQGRVDDNIDTFKKRLKVFEAMSLPVVHHYSKKGKLHKLFSSDALT
FLRDLAQIKRGGRRGRNLRTSSRCFRFTRDDD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25280 P-loop containing nucleoside t... Lus10031135 0 1
AT4G36720 HVA22K HVA22-like protein K (.1) Lus10010093 13.5 0.8245
AT3G07750 3'-5'-exoribonuclease family p... Lus10006382 16.2 0.7779
AT1G50575 Putative lysine decarboxylase ... Lus10003762 20.9 0.8217
AT2G27790 RNA-binding (RRM/RBD/RNP motif... Lus10030600 22.4 0.8166
AT2G17900 ASHR1, SDG37 ASH1-related 1, SET domain gro... Lus10029712 22.4 0.8055
AT4G37020 unknown protein Lus10000435 22.8 0.7906
AT5G09250 KIWI ssDNA-binding transcriptional ... Lus10013733 30.2 0.7822
AT2G37680 PAT3, FRY1, FHY... unknown protein Lus10003966 31.7 0.7632
AT4G35980 unknown protein Lus10028436 37.5 0.7985
AT3G05675 BTB/POZ domain-containing prot... Lus10021269 37.8 0.7505

Lus10031135 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.