Lus10031138 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62360 152 / 2e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25260 124 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G62350 122 / 9e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62760 124 / 3e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G47380 111 / 1e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G62770 110 / 3e-30 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G14890 106 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G01610 105 / 7e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G25250 100 / 2e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G12390 97 / 4e-25 PME1 pectin methylesterase inhibitor 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031717 254 / 9e-87 AT5G62360 179 / 3e-57 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038915 164 / 5e-51 AT5G62360 174 / 5e-55 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027199 160 / 1e-49 AT5G62360 169 / 3e-53 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10038914 126 / 1e-36 AT5G62350 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10027198 126 / 2e-36 AT5G62350 191 / 3e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031133 125 / 5e-36 AT5G62350 211 / 8e-70 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10031711 125 / 9e-36 AT5G62360 145 / 4e-44 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10028910 125 / 1e-35 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10004327 119 / 2e-33 AT1G62760 164 / 8e-50 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G128100 178 / 1e-56 AT5G62360 221 / 1e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128200 172 / 3e-54 AT5G62360 172 / 1e-54 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128300 165 / 1e-51 AT5G62360 192 / 1e-62 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.012G127500 129 / 1e-37 AT5G62350 220 / 2e-73 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128700 126 / 3e-36 AT5G62350 221 / 7e-74 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G119300 124 / 1e-35 AT1G62760 167 / 3e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113600 124 / 1e-35 AT1G62760 171 / 1e-52 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G113700 117 / 9e-33 AT4G12390 178 / 1e-56 pectin methylesterase inhibitor 1 (.1)
Potri.010G109300 117 / 1e-32 AT1G14890 218 / 5e-72 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.015G128400 111 / 2e-30 AT5G62360 134 / 2e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10031138 pacid=23151092 polypeptide=Lus10031138 locus=Lus10031138.g ID=Lus10031138.BGIv1.0 annot-version=v1.0
ATGTCGGCGCCGACATCATCCTCCGCCTACGCTCTCCTCGCCGTCACTTTGTTACTAGCCTCCACGTCATCAGCCTCAAGACCCATTTCCTCCTCCTCCG
CCGGCGCCACAAACACAGAGTTCATCCGTACGTCATGCACCGCCACGTCATACCCGAAGCTATGCTACACCTCCTTATCAACCCACGTTACCAAAATCCA
GACTAGCCCCAAGCTCCTGGCCTCTGCCGCCCTTCATGTGGCGCTGTCATCGGCGAAGTCAGCTTTAACTGAGATGGCCGAGCACTCCCGAGGCCACCTG
CATGGCCCTCGTGAGGTGGGGGCCATACAAGATTGCGTGGAGGAGCTTGGAGACTCTGTTGACCAAATTCACGAATCGGTCAACAAAATGGAGGGCAAGG
GAAAAGATAGTGGTGAGGAGGGTGCGGATTTCGAGAGGATGATTAACGACGTGGAGACTTGGGTCAGCGCGGCGTTGACCGACCAGGGCACGTGCAGCGA
CGGGTTCGGAGAGATGGACGGAGAGTTAAGAGAGGCTGTGAAAGGGAAGGTTGTTAGAGTTGCTAAGCTTACTAGTAATGCCTTGGATTTGATTAGCAAC
TATGCTTCTCTACATTGA
AA sequence
>Lus10031138 pacid=23151092 polypeptide=Lus10031138 locus=Lus10031138.g ID=Lus10031138.BGIv1.0 annot-version=v1.0
MSAPTSSSAYALLAVTLLLASTSSASRPISSSSAGATNTEFIRTSCTATSYPKLCYTSLSTHVTKIQTSPKLLASAALHVALSSAKSALTEMAEHSRGHL
HGPREVGAIQDCVEELGDSVDQIHESVNKMEGKGKDSGEEGADFERMINDVETWVSAALTDQGTCSDGFGEMDGELREAVKGKVVRVAKLTSNALDLISN
YASLH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62360 Plant invertase/pectin methyle... Lus10031138 0 1
AT1G60060 Serine/threonine-protein kinas... Lus10018736 1.4 0.9775
AT1G03220 Eukaryotic aspartyl protease f... Lus10034035 1.4 0.9754
AT5G54010 UDP-Glycosyltransferase superf... Lus10013337 2.4 0.9652
AT2G26250 KCS10, FDH FIDDLEHEAD, 3-ketoacyl-CoA syn... Lus10009799 2.8 0.9648
AT4G00165 Bifunctional inhibitor/lipid-t... Lus10015883 3.2 0.9493
AT1G68260 Thioesterase superfamily prote... Lus10031948 3.5 0.9483
AT1G60060 Serine/threonine-protein kinas... Lus10024800 5.9 0.9482
AT2G27385 Pollen Ole e 1 allergen and ex... Lus10004847 6.2 0.9355
AT2G24800 Peroxidase superfamily protein... Lus10020097 8.1 0.9237
AT4G00165 Bifunctional inhibitor/lipid-t... Lus10009282 8.7 0.9195

Lus10031138 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.