Lus10031150 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05010 114 / 2e-29 ACO4, EAT1, EFE ethylene forming enzyme, ethylene-forming enzyme (.1)
AT2G30830 114 / 2e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT2G36690 110 / 8e-28 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10490 109 / 1e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G62380 108 / 1e-27 ATACO2, ACO2 ACC oxidase 2 (.1)
AT1G06620 109 / 2e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G77330 108 / 2e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G19000 107 / 1e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06645 106 / 3e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G49630 105 / 3e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024230 211 / 5e-67 AT3G19000 149 / 3e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10023602 203 / 8e-64 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10000857 122 / 3e-32 AT1G77330 440 / 2e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10028678 113 / 5e-29 AT1G77330 435 / 1e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 113 / 1e-28 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022191 112 / 2e-28 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 111 / 4e-28 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022192 109 / 1e-27 AT5G43440 372 / 1e-128 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10021203 108 / 3e-27 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G069200 201 / 6e-63 AT3G19000 147 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.002G078600 132 / 2e-36 AT1G77330 455 / 1e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G182700 132 / 3e-36 AT1G77330 461 / 4e-165 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.004G003000 115 / 4e-30 AT1G05010 467 / 6e-167 ethylene forming enzyme, ethylene-forming enzyme (.1)
Potri.014G159000 113 / 3e-29 AT1G05010 464 / 8e-166 ethylene forming enzyme, ethylene-forming enzyme (.1)
Potri.002G224100 112 / 4e-29 AT1G05010 440 / 2e-156 ethylene forming enzyme, ethylene-forming enzyme (.1)
Potri.011G020900 110 / 3e-28 AT1G05010 473 / 1e-169 ethylene forming enzyme, ethylene-forming enzyme (.1)
Potri.017G048700 108 / 3e-27 AT2G36690 255 / 3e-82 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.012G006300 108 / 4e-27 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451600 107 / 6e-27 AT4G10500 406 / 5e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10031150 pacid=23151146 polypeptide=Lus10031150 locus=Lus10031150.g ID=Lus10031150.BGIv1.0 annot-version=v1.0
ATGGCCTACAACTACCCGGTGATCGATCTGGCCCCATTCCTCACCAGCTCCGGGGATGCCAAGAAGAAGGCGGAGGTGATTGAGAAGCTGAGGGAAGCTT
GCTCCGACTATGGCTTCTTCGTGGCGGTCAACCACGGCATCCCGGACGAGACCATGGACAAAACCATGGACGTGACCATAGATTTCTTCAACCTCGATTT
GGACGAGAAACTCAAAATCACCACCCCGCCGGGCGCTCCTCTCGCCGCCGGCTACCGTCACAAGGAGACAATGGAGGAAATGTGGTGGAAATTGGATGAA
GCGGCGCAGGTGGTACAGAAGTTGTTGAACGAAGCTCTGAGACTCCCAGAAGGGACGTTGGCCAAGTACAACGACAACAGGGGGACCGACATTCTGTTGG
GATTCCACTACTTGCCGGCGACGGAGACCGAAAAGACGGCGGTCAACGCACACAGGGACAACGGTCTCTTTAGTTTGGTGTTCGAGAATGAAGTTGAAGG
ACTCGAGTTTCTAAAAGACGGCGAGTGGATTCCCATCGATCCCATCCCCCATTCCCTCGTTATCAACGTCGGCGACGCCCTCCAGGCATTGAGCAATGAC
AAGATGAAGAGCCCGACCCACAGGATTTTGGCGCAGCCGGGGAAAAGCCGATATGCATTTGTGTACGGGTACATGGTAGCAGAAGAGAAGTGGGTTGAGC
CGATGCCTGAGTTGATCGGTCAGACCAACGAGTCGCCCAAGTTCAAGAAGTTCAACATCAAAGAGCACATGGCGCTCAAGCAAGTGTTCAAGAACCCTCC
TCCTCACTGGAACGACGTCGTCGGTGTTCATTACCATGCCATCACTCCGTCCGCCGCCGCCGCCGCCAACTGA
AA sequence
>Lus10031150 pacid=23151146 polypeptide=Lus10031150 locus=Lus10031150.g ID=Lus10031150.BGIv1.0 annot-version=v1.0
MAYNYPVIDLAPFLTSSGDAKKKAEVIEKLREACSDYGFFVAVNHGIPDETMDKTMDVTIDFFNLDLDEKLKITTPPGAPLAAGYRHKETMEEMWWKLDE
AAQVVQKLLNEALRLPEGTLAKYNDNRGTDILLGFHYLPATETEKTAVNAHRDNGLFSLVFENEVEGLEFLKDGEWIPIDPIPHSLVINVGDALQALSND
KMKSPTHRILAQPGKSRYAFVYGYMVAEEKWVEPMPELIGQTNESPKFKKFNIKEHMALKQVFKNPPPHWNDVVGVHYHAITPSAAAAAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G10490 2-oxoglutarate (2OG) and Fe(II... Lus10031150 0 1
AT3G50280 HXXXD-type acyl-transferase fa... Lus10031149 1.0 0.9893
AT1G75240 ZF_HD ATHB33, ZHD5 zinc-finger homeodomain 5, hom... Lus10031885 2.8 0.9522
AT4G39490 CYP96A10 "cytochrome P450, family 96, s... Lus10035235 3.3 0.9371
AT1G20190 ATHEXPALPHA1.14... EXPANSIN 11, expansin 11 (.1) Lus10021845 4.7 0.9579
AT3G20820 Leucine-rich repeat (LRR) fami... Lus10010949 4.9 0.9579
AT3G18200 nodulin MtN21 /EamA-like trans... Lus10027251 6.9 0.9367
AT5G07720 Galactosyl transferase GMA12/M... Lus10015721 6.9 0.9193
Lus10024121 7.5 0.9413
AT1G75240 ZF_HD ATHB33, ZHD5 zinc-finger homeodomain 5, hom... Lus10031315 7.7 0.9456
AT1G31690 Copper amine oxidase family pr... Lus10026757 7.7 0.9494

Lus10031150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.