Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47440 67 / 1e-14 TIP5;1 tonoplast intrinsic protein 5;1 (.1) AT3G16240 65 / 1e-13 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT5G47450 59 / 3e-11 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT3G26520 54 / 2e-09 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT2G36830 52 / 7e-09 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) AT1G73190 47 / 3e-07 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT4G01470 47 / 3e-07 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT4G17340 45 / 1e-06 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT1G17810 44 / 7e-06 BETA-TIP beta-tonoplast intrinsic protein (.1) AT2G25810 39 / 0.0003 TIP4;1 tonoplast intrinsic protein 4;1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038293 [exp] 63 / 9e-13 AT3G16240 396 / 2e-141 delta tonoplast integral protein (.1) Lus10025808 [exp] 62 / 1e-12 AT3G16240 389 / 2e-138 delta tonoplast integral protein (.1) Lus10022611 [exp] 49 / 9e-08 AT2G36830 403 / 5e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10021510 [exp] 49 / 1e-07 AT2G36830 402 / 9e-144 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10003288 [exp] 47 / 3e-07 AT4G01470 388 / 6e-138 tonoplast intrinsic protein 1;3 (.1) Lus10018256 [exp] 45 / 2e-06 AT1G17810 370 / 7e-131 beta-tonoplast intrinsic protein (.1) Lus10023913 [exp] 44 / 4e-06 AT2G36830 391 / 3e-139 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Lus10036187 [exp] 44 / 6e-06 AT1G73190 382 / 4e-135 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) Lus10005885 [exp] 44 / 6e-06 AT4G01470 395 / 1e-140 tonoplast intrinsic protein 1;3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G124800 [exp] 105 / 7e-29 AT3G47440 317 / 7e-110 tonoplast intrinsic protein 5;1 (.1) Potri.003G108500 [exp] 101 / 2e-27 AT3G47440 320 / 5e-111 tonoplast intrinsic protein 5;1 (.1) Potri.003G050900 [exp] 66 / 4e-14 AT3G16240 311 / 5e-108 delta tonoplast integral protein (.1) Potri.001G186700 [exp] 66 / 6e-14 AT3G16240 372 / 8e-132 delta tonoplast integral protein (.1) Potri.009G005400 [exp] 56 / 4e-10 AT2G36830 355 / 7e-125 TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1) Potri.017G154800 [exp] 53 / 2e-09 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1) Potri.004G216500 [exp] 53 / 2e-09 AT4G01470 331 / 2e-115 tonoplast intrinsic protein 1;3 (.1) Potri.006G239700 [exp] 53 / 2e-09 AT2G25810 355 / 5e-125 tonoplast intrinsic protein 4;1 (.1) Potri.001G235300 [exp] 52 / 5e-09 AT4G01470 375 / 8e-133 tonoplast intrinsic protein 1;3 (.1) Potri.009G027200 [exp] 51 / 1e-08 AT4G01470 367 / 7e-130 tonoplast intrinsic protein 1;3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [flax] [poplar] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Lus10031157 pacid=23151063 polypeptide=Lus10031157 locus=Lus10031157.g ID=Lus10031157.BGIv1.0 annot-version=v1.0 ATGCCTCCGATCTCACTCTCGTCCCGCTTCCACCAATCCGTAACCCCGGCAGCCCTCAGATCGTACCTCGCCGAGTTCATCTCCACCTTCTTCTTCGTCT TCGCCGTCGTCGGCTCTTCCATGGCTTCCAAGAAACTGACCCCTGATCAAGCCGGCGGCGGCGGCAGCTCGGCGGGTCTTGTGACGGTGGCGATGGCAAA CGCGTTTGCACTTTCCTCGGCGGTTTACGTTGCCGCCGGAGCCTCTGGTGGACACGTCAACCCCGCCGTCACTTTCGCGATGGCTGGCGGGGGCCCAGCC AATATTAATATGTTCGAAATTTCATATGTTAAAGGTGTAATACGGATGTAG
AA sequence Show only first row Show all	>Lus10031157 pacid=23151063 polypeptide=Lus10031157 locus=Lus10031157.g ID=Lus10031157.BGIv1.0 annot-version=v1.0 MPPISLSSRFHQSVTPAALRSYLAEFISTFFFVFAVVGSSMASKKLTPDQAGGGGSSAGLVTVAMANAFALSSAVYVAAGASGGHVNPAVTFAMAGGGPA NINMFEISYVKGVIRM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031157 [exp]	0	1
AT3G14690		CYP72A15	"cytochrome P450, family 72, s...		Lus10026177 [exp]	2.8	0.8668
AT3G05250			RING/U-box superfamily protein...		Lus10010911 [exp]	3.0	0.8689
AT3G07610		IBM1	increase in bonsai methylation...		Lus10004549 [exp]	4.6	0.8649
AT3G02125			unknown protein		Lus10013196 [exp]	6.6	0.8588
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10023901 [exp]	7.5	0.8399
					Lus10005955 [exp]	8.5	0.8450
AT4G39250	MYB	RSM2, ATRL1	RADIALIS-LIKE SANT/MYB 2, RAD-...		Lus10041744 [exp]	10.9	0.8405
					Lus10004431 [exp]	11.5	0.8201
AT4G35160			O-methyltransferase family pro...		Lus10008538 [exp]	17.9	0.8561
AT3G09640		APX1B, APX2	ASCORBATE PEROXIDASE 1B, ascor...		Lus10019906 [exp]	18.6	0.7996

Compare expression of checked genes

Lus10031157 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.