Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G47440 121 / 4e-35 TIP5;1 tonoplast intrinsic protein 5;1 (.1) AT3G16240 73 / 1e-16 DELTA-TIP1, ATTIP2;1, AQP1, DELTA-TIP delta tonoplast integral protein (.1) AT4G17340 72 / 4e-16 TIP2;2, DELTA-TIP2 tonoplast intrinsic protein 2;2 (.1) AT1G73190 71 / 1e-15 ALPHA-TIP, TIP3;1 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) AT5G47450 67 / 1e-14 ATTIP2;3, DELTA-TIP3 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) AT1G17810 66 / 5e-14 BETA-TIP beta-tonoplast intrinsic protein (.1) AT2G25810 64 / 2e-13 TIP4;1 tonoplast intrinsic protein 4;1 (.1) AT4G01470 63 / 7e-13 ATTIP1.3, GAMMA-TIP3, TIP1;3 tonoplast intrinsic protein 1;3 (.1) AT3G26520 62 / 2e-12 TIP1;2, SITIP, GAMMA-TIP2, TIP2 SALT-STRESS INDUCIBLE TONOPLAST INTRINSIC PROTEIN, tonoplast intrinsic protein 2 (.1) AT2G36830 60 / 7e-12 TIP1;1, GAMMA-TIP1, GAMMA-TIP TONOPLAST INTRINSIC PROTEIN 1;1, GAMMA TONOPLAST INTRINSIC PROTEIN 1, gamma tonoplast intrinsic protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031735 [exp] 165 / 2e-53 AT3G47440 208 / 2e-68 tonoplast intrinsic protein 5;1 (.1) Lus10007796 [exp] 73 / 2e-16 AT5G47450 389 / 1e-138 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10004733 [exp] 73 / 2e-16 AT5G47450 393 / 4e-140 DELTA-TONOPLAST INTRINSIC PROTEIN 3, ARABIDOPSIS THALIANA TONOPLAST INTRINSIC PROTEIN 2;3, tonoplast intrinsic protein 2;3 (.1) Lus10038293 [exp] 68 / 1e-14 AT3G16240 396 / 2e-141 delta tonoplast integral protein (.1) Lus10018256 [exp] 67 / 2e-14 AT1G17810 370 / 7e-131 beta-tonoplast intrinsic protein (.1) Lus10040652 [exp] 67 / 4e-14 AT1G17810 367 / 2e-129 beta-tonoplast intrinsic protein (.1) Lus10037895 [exp] 66 / 4e-14 AT2G25810 371 / 2e-131 tonoplast intrinsic protein 4;1 (.1) Lus10036187 [exp] 66 / 5e-14 AT1G73190 382 / 4e-135 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1) Lus10038324 [exp] 66 / 5e-14 AT1G73190 380 / 1e-134 ALPHA-TONOPLAST INTRINSIC PROTEIN, Aquaporin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G124800 [exp] 140 / 1e-42 AT3G47440 317 / 7e-110 tonoplast intrinsic protein 5;1 (.1) Potri.003G108500 [exp] 135 / 9e-41 AT3G47440 320 / 5e-111 tonoplast intrinsic protein 5;1 (.1) Potri.003G050900 [exp] 72 / 2e-16 AT3G16240 311 / 5e-108 delta tonoplast integral protein (.1) Potri.018G152100 [exp] 71 / 9e-16 AT1G17810 350 / 8e-123 beta-tonoplast intrinsic protein (.1) Potri.017G154800 [exp] 71 / 1e-15 AT1G17810 372 / 1e-131 beta-tonoplast intrinsic protein (.1) Potri.001G186700 [exp] 70 / 2e-15 AT3G16240 372 / 8e-132 delta tonoplast integral protein (.1) Potri.003G077800 [exp] 69 / 3e-15 AT4G17340 351 / 2e-123 tonoplast intrinsic protein 2;2 (.1) Potri.010G209900 [exp] 65 / 2e-13 AT4G01470 389 / 2e-138 tonoplast intrinsic protein 1;3 (.1) Potri.008G050700 [exp] 64 / 2e-13 AT4G01470 387 / 2e-137 tonoplast intrinsic protein 1;3 (.1) Potri.001G157000 [exp] 62 / 2e-12 AT4G17340 333 / 3e-116 tonoplast intrinsic protein 2;2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00230 [flax] [poplar] MIP Major intrinsic protein
Representative CDS sequence Show only first row Show all	>Lus10031158 pacid=23151179 polypeptide=Lus10031158 locus=Lus10031158.g ID=Lus10031158.BGIv1.0 annot-version=v1.0 ATGACGGGATTCGGAGCATCAATGCTGGAAGGTTTTCTAACATTTGTGTTGGTGTACACCGTCTACGCATGTAACGACCCCAGGCGTGGACCGTTGACCG CGATTGGGCCGCTGGTTGTAGGGGTAACCGCTGGAGCGGGTGTGTTGGCGGCTGGGCCATTCTCGGGTGGGGCGATGAACCCGGCTTGTGCGTTTGGGTC GGCGGTTATTGCCGGGAAGTTTAGGAACCAGGCGGTTTACTGGGTTGGACCATTGATTGGGGCGGCAGCTGCGGGTTTGATTTATGATAACGTTGTGTAT CCTCCTGCTGAGCCGAGTGATTCGATTAGAGGGGATGGTGAAGGTGTAGGGGTTTGA
AA sequence Show only first row Show all	>Lus10031158 pacid=23151179 polypeptide=Lus10031158 locus=Lus10031158.g ID=Lus10031158.BGIv1.0 annot-version=v1.0 MTGFGASMLEGFLTFVLVYTVYACNDPRRGPLTAIGPLVVGVTAGAGVLAAGPFSGGAMNPACAFGSAVIAGKFRNQAVYWVGPLIGAAAAGLIYDNVVY PPAEPSDSIRGDGEGVGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G47440		TIP5;1	tonoplast intrinsic protein 5;...		Lus10031158 [exp]	0	1
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Lus10040300 [exp]	3.6	0.9215
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10038526 [exp]	5.2	0.9576
AT5G53970		TAT7	tyrosine aminotransferase 7, T...		Lus10032654 [exp]	7.5	0.9309
AT4G19810		ChiC	class V chitinase, Glycosyl hy...		Lus10036310 [exp]	7.6	0.9390
AT1G18910			zinc ion binding;zinc ion bind...		Lus10042190 [exp]	13.7	0.9220
AT5G44390			FAD-binding Berberine family p...		Lus10038442 [exp]	15.1	0.9356
AT2G29090		CYP707A2	"cytochrome P450, family 707, ...		Lus10016515 [exp]	18.2	0.8741
AT3G07840			Pectin lyase-like superfamily ...		Lus10043087 [exp]	23.9	0.8462
AT3G05670			RING/U-box protein (.1)		Lus10007973 [exp]	24.7	0.8964
AT5G53450		ORG1	OBP3-responsive gene 1 (.1.2)		Lus10014920 [exp]	25.5	0.9215

Compare expression of checked genes

Lus10031158 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.