Lus10031180 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06040 172 / 9e-55 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
AT1G70190 105 / 2e-28 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
AT4G37660 98 / 7e-26 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT4G36420 89 / 3e-22 Ribosomal protein L12 family protein (.1)
AT2G03130 60 / 5e-12 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
AT3G27850 58 / 1e-10 RPL12-C ribosomal protein L12-C (.1)
AT3G27830 58 / 2e-10 RPL12-A ribosomal protein L12-A (.1)
AT3G27840 48 / 5e-07 RPL12-B ribosomal protein L12-B (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031756 315 / 9e-111 AT3G06040 202 / 2e-66 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Lus10036228 100 / 2e-26 AT1G70190 238 / 3e-80 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10038367 100 / 2e-26 AT1G70190 243 / 3e-82 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Lus10023839 94 / 2e-24 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10000093 94 / 2e-24 AT4G37660 155 / 1e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10041783 94 / 5e-24 AT4G36420 174 / 5e-56 Ribosomal protein L12 family protein (.1)
Lus10028336 92 / 3e-23 AT4G36420 176 / 1e-56 Ribosomal protein L12 family protein (.1)
Lus10021011 92 / 4e-23 AT4G37660 157 / 3e-49 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Lus10013078 64 / 2e-12 AT3G27830 175 / 7e-56 ribosomal protein L12-A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G077200 230 / 2e-77 AT3G06040 132 / 3e-39 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2.3)
Potri.003G074800 108 / 1e-29 AT1G70190 204 / 1e-66 Ribosomal protein L7/L12, oligomerisation;Ribosomal protein L7/L12, C-terminal/adaptor protein ClpS-like (.1.2)
Potri.004G224300 101 / 5e-27 AT4G37660 154 / 4e-48 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1)
Potri.007G019100 99 / 5e-26 AT4G36420 127 / 2e-37 Ribosomal protein L12 family protein (.1)
Potri.001G346100 60 / 3e-11 AT3G27830 146 / 1e-44 ribosomal protein L12-A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00542 Ribosomal_L12 Ribosomal protein L7/L12 C-terminal domain
Representative CDS sequence
>Lus10031180 pacid=23151020 polypeptide=Lus10031180 locus=Lus10031180.g ID=Lus10031180.BGIv1.0 annot-version=v1.0
ATGAAGCTCATTGCACTGGCAAGATCATTCCGCTCCTCTCCGGCAGCCATCCGCGAGATCAATGGCTTCTTACAGGTCAGATTTTTCCAGCACGACTTCG
TTCCCAGAGACCCATCGGCGAAGCCGACGAAGTACAAGTATCCCGAAGTCTACAATCCGTACGGTCCGAGACCACCTCCATCAGACAAAATCATTCAGCT
CGCTGAGCAAATCGCTGCGTTACCTCTCGACGAGAGGAAGCAAATCGGCCCTGCTCTCGGGTTGAAGCTGAGCCATCCGAAGCTGGAGACGATCTCTACG
GAAGGAATGGAGCTTGGACCAGCTGGATCGGGAGGTGGATCGGCGGCTGGGAAGGCGGTGGAGGAGAAGAAGGAGAAGACTGCATTCGACGTTAAATTGG
AGAAGTTTGATGCAGCTGCGAAGATCAAAGTGATTAAAGAAGTTCGAGCTTTCACGAACTTGGGGTTGAAAGAAGCTAAGGAATTGGTTGAGAAAGCTCC
CGTTGTGCTTAAACAAGGAGTCACCAAAGACGAAGGGAATAGTGTCATTGAGAAGATTAAGGCTGCTGGTGGTGTTGCTGTCATGGAGTAA
AA sequence
>Lus10031180 pacid=23151020 polypeptide=Lus10031180 locus=Lus10031180.g ID=Lus10031180.BGIv1.0 annot-version=v1.0
MKLIALARSFRSSPAAIREINGFLQVRFFQHDFVPRDPSAKPTKYKYPEVYNPYGPRPPPSDKIIQLAEQIAALPLDERKQIGPALGLKLSHPKLETIST
EGMELGPAGSGGGSAAGKAVEEKKEKTAFDVKLEKFDAAAKIKVIKEVRAFTNLGLKEAKELVEKAPVVLKQGVTKDEGNSVIEKIKAAGGVAVME

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06040 Ribosomal protein L12/ ATP-dep... Lus10031180 0 1
AT3G16780 Ribosomal protein L19e family ... Lus10038417 5.9 0.9143
AT3G53740 Ribosomal protein L36e family ... Lus10016466 8.0 0.8897
AT5G59850 Ribosomal protein S8 family pr... Lus10040309 16.5 0.8793
AT4G24830 arginosuccinate synthase famil... Lus10012800 18.8 0.8754
AT1G23100 GroES-like family protein (.1) Lus10036055 22.2 0.8570
AT3G46560 TIM9, EMB2474 embryo defective 2474, Tim10/D... Lus10037964 26.6 0.8691
AT1G65290 MTACP2 mitochondrial acyl carrier pro... Lus10020221 26.9 0.8184
AT3G56070 ROC2 rotamase cyclophilin 2 (.1.2) Lus10022012 27.1 0.8585
AT5G28060 Ribosomal protein S24e family ... Lus10000938 32.6 0.8625
AT3G06040 Ribosomal protein L12/ ATP-dep... Lus10031756 36.0 0.8249

Lus10031180 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.