Lus10031189 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G43000 253 / 7e-83 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1)
AT3G12910 252 / 6e-82 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT5G39820 229 / 8e-73 NAC ANAC094 NAC domain containing protein 94 (.1)
AT1G26870 223 / 3e-69 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
AT2G02450 174 / 8e-51 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2)
AT1G61110 172 / 9e-51 NAC ANAC025 NAC domain containing protein 25 (.1)
AT5G63790 171 / 1e-50 NAC ANAC102 NAC domain containing protein 102 (.1)
AT1G69490 169 / 2e-50 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
AT3G15510 170 / 1e-49 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
AT3G04070 169 / 2e-49 NAC ANAC047 NAC domain containing protein 47 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031767 330 / 8e-114 AT2G43000 236 / 3e-78 NAC domain containing protein 42 (.1)
Lus10030478 238 / 6e-75 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1)
Lus10036749 238 / 1e-74 AT1G26870 306 / 4e-100 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10037178 238 / 2e-74 AT5G39820 306 / 3e-101 NAC domain containing protein 94 (.1)
Lus10038332 231 / 4e-74 AT2G43000 231 / 1e-75 NAC domain containing protein 42 (.1)
Lus10036194 228 / 4e-73 AT3G12910 224 / 1e-72 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10015367 230 / 8e-73 AT1G26870 298 / 8e-99 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Lus10007263 228 / 4e-72 AT5G39820 300 / 3e-100 NAC domain containing protein 94 (.1)
Lus10031766 201 / 7e-64 AT3G12910 61 / 2e-11 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G098000 322 / 2e-109 AT3G12910 271 / 2e-90 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.007G066300 318 / 4e-108 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.005G205400 250 / 2e-81 AT2G43000 269 / 6e-90 NAC domain containing protein 42 (.1)
Potri.002G057200 249 / 6e-81 AT2G43000 282 / 4e-95 NAC domain containing protein 42 (.1)
Potri.001G080900 248 / 2e-80 AT2G43000 257 / 3e-85 NAC domain containing protein 42 (.1)
Potri.003G149700 239 / 4e-77 AT2G43000 245 / 2e-80 NAC domain containing protein 42 (.1)
Potri.004G126901 223 / 1e-69 AT5G39820 305 / 1e-101 NAC domain containing protein 94 (.1)
Potri.017G082000 223 / 2e-69 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Potri.003G166500 173 / 4e-52 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1)
Potri.001G404400 176 / 6e-52 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02365 NAM No apical meristem (NAM) protein
Representative CDS sequence
>Lus10031189 pacid=23150999 polypeptide=Lus10031189 locus=Lus10031189.g ID=Lus10031189.BGIv1.0 annot-version=v1.0
ATGAACTCTAGTACTATAACCTCTGATGATAACTGTGATGATCATCGGGATCGTGAGGAGGAGGAGGAAGAAGAGGAAGAAGACGACGACATTTCGCTAC
CGGGGTTCCGATTCCATCCGACGGACGAAGAGCTTCTGAGCTTTTATCTACGGAGGAAAGTTGACAACAAGCCCCTCAGCATCGAGCTCATCAAGCAAGT
TGATATCTACAAATATGATCCATGGGATCTTCCAAGATCAACTGGGGATGGAGATAAAGAAGGCTACTTCTTCTGTAGAAGAGGGAGGAAGTACAGGAAC
AGCATCCGGCCAAATCGGGTTACCGGTTCCGGGTTCTGGAAAGCAACCGGGATCGACAAACCGGTTTACTCAATGGCCGGAGACAACTGCATTGGGCTGA
AGAAGACTTTGGTTTACTACAGGGGCAGCGCCGGAAAGGGAACCAAAACCGATTGGATGATGCACGAATTTCGCCTCCCGACCTCGGATCAAACCGGTAC
CAACAACATCAATAGCTACATCGCTAGCTTGGAATCCTCGAAGCTCATATCCGCCCAAGAAGCTGAGGTATGGACGATATGTCGAATCTTCAAGAGAAAT
TCATCCAACAGAAAGTACACCCCAGACTGGAGAGAATTGTCCACCTCCAAACGGCCCCTTACTAACCCTAATTCCAACAATTACAACAACAACAACACCT
CAGGAGCTACAAGAACTCATCAGCAACACTTCATCGACTTCACTGCCCCCCACGTCCAATCATTCGACACGAAACCCCCGACGAGCCAGCACCACATGGC
GGGGCCAGCACAAGACGATGATCAATCCATCATCATGTCCACGATGATGATGATGGACAGATCCTCGTCTATTATTACACCATCCAGACCGACAACTGCA
TTACATTCTACGAATTCTTCCTCTCATCATTCAGAGTTGGTGGCTCCTCAGAGCAGTTCCTCGATGGCTTCATCGACCTCGAACATTTCAAGCCCCTACG
GGAACGATCAGTTCCTGACATACGGAGACTTCGACGAGCTTAGATCTGTGGTCGAGTTTGCCTTCGATCCTTCCAATAACTTCCTGTAA
AA sequence
>Lus10031189 pacid=23150999 polypeptide=Lus10031189 locus=Lus10031189.g ID=Lus10031189.BGIv1.0 annot-version=v1.0
MNSSTITSDDNCDDHRDREEEEEEEEEDDDISLPGFRFHPTDEELLSFYLRRKVDNKPLSIELIKQVDIYKYDPWDLPRSTGDGDKEGYFFCRRGRKYRN
SIRPNRVTGSGFWKATGIDKPVYSMAGDNCIGLKKTLVYYRGSAGKGTKTDWMMHEFRLPTSDQTGTNNINSYIASLESSKLISAQEAEVWTICRIFKRN
SSNRKYTPDWRELSTSKRPLTNPNSNNYNNNNTSGATRTHQQHFIDFTAPHVQSFDTKPPTSQHHMAGPAQDDDQSIIMSTMMMMDRSSSIITPSRPTTA
LHSTNSSSHHSELVAPQSSSSMASSTSNISSPYGNDQFLTYGDFDELRSVVEFAFDPSNNFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12910 NAC NAC (No Apical Meristem) domai... Lus10031189 0 1
AT2G43000 NAC ANAC042, JUB1, ... NAC domain containing protein ... Lus10038332 3.3 0.8820
AT1G79690 ATNUDT3 nudix hydrolase homolog 3 (.1) Lus10041626 5.3 0.8740
Lus10029825 13.3 0.8465
Lus10010256 14.8 0.7576
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10019801 16.0 0.8423
AT4G15440 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) Lus10035289 21.4 0.8539
AT5G46080 Protein kinase superfamily pro... Lus10015326 29.7 0.8614
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10025741 32.2 0.8535
AT2G16430 ATPAP10, PAP10 purple acid phosphatase 10 (.1... Lus10017485 36.0 0.8529
AT1G33030 O-methyltransferase family pro... Lus10009442 37.4 0.8526

Lus10031189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.