Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56090 233 / 6e-76 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G25230 72 / 4e-14 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT4G30480 66 / 4e-12 TPR1, AtTPR1 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) AT5G48570 63 / 6e-11 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G54010 62 / 2e-10 DEI1, PAS1 PASTICCINO 1, FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1.2) AT1G62390 61 / 3e-10 CLMP1, Phox2 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) AT1G58450 57 / 5e-10 TPR6 tetratricopeptide repeat 6, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G17970 59 / 1e-09 ATTOC64-III translocon at the outer membrane of chloroplasts 64-III (.1) AT5G09420 54 / 5e-08 MTOM64, ATTOC64-V, AtmtOM64 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1) AT3G58620 54 / 6e-08 TTL4 tetratricopetide-repeat thioredoxin-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031774 [exp] 449 / 8e-161 AT1G56090 259 / 2e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008024 [exp] 373 / 2e-131 AT1G56090 218 / 8e-71 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038216 [exp] 73 / 3e-14 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 72 / 8e-14 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10035117 [exp] 65 / 6e-12 AT4G30480 291 / 3e-99 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10002338 [exp] 65 / 2e-11 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10003171 [exp] 64 / 3e-11 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10031983 [exp] 64 / 5e-11 AT4G30480 222 / 9e-76 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Lus10039592 [exp] 63 / 7e-11 AT1G62390 888 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G097300 [exp] 275 / 5e-92 AT1G56090 260 / 2e-86 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G248300 [exp] 74 / 1e-14 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.018G100700 [exp] 71 / 7e-14 AT4G30480 303 / 8e-104 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.014G149400 [exp] 68 / 1e-12 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.004G002900 [exp] 67 / 3e-12 AT1G62390 926 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.011G021000 [exp] 67 / 4e-12 AT1G62390 885 / 0.0 Phox2, CLUMPED CHLOROPLASTS 1, Octicosapeptide/Phox/Bem1p (PB1) domain-containing protein / tetratricopeptide repeat (TPR)-containing protein (.1) Potri.002G117200 [exp] 65 / 2e-11 AT5G48570 553 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.006G178900 [exp] 63 / 2e-11 AT4G30480 275 / 1e-92 tetratricopeptide repeat 1, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3) Potri.001G205300 [exp] 57 / 5e-09 AT5G09420 724 / 0.0 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1) Potri.010G007000 [exp] 54 / 5e-08 AT3G16760 267 / 6e-84 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF00515 [flax] [poplar] TPR_1 Tetratricopeptide repeat
Representative CDS sequence Show only first row Show all	>Lus10031195 pacid=23151083 polypeptide=Lus10031195 locus=Lus10031195.g ID=Lus10031195.BGIv1.0 annot-version=v1.0 ATGGCGTCGTCTCCGCAATCTCCAGCGAACAAGATCGAGTCAGCTCACCAGCTCTACAGAGACGGCAAGTACGCCGTCGCGCTTGGATTCTACACGGAAG CGCTTTCGATGATGGCCAACACCAGCCCTCAGAAGATCTCCCTCCACAGCAACCGAGCTGCTTGCTATCTCAAGCTCCACGATTTCAAGAAGGCGGCTGA AGAGTGTACATCCGTGCTTGAGCTTGATCAAAACCACGCTGGAGCGTTGATGCTGCGGGCGCAGACATTAGTTACTCTCAAAGACTATCACTCTGCGCTC TTTGATGTCAATCGGCTGTTGGAGCTGGATCCTGATTCTGAAGTTTACCAGAACCTTGAAACTCGTTTGAGGACACAGTTGTCCCTAGCTTCAATACCTG AGTCTGAAGCTGAACTGGAAGAAGAGGACGAGAGTGAATCGGAAGACGAACAAGACGGCATAGAGCAGACCAGTAACCTCGAGCCTGATGAAAGTAGGAA CGAAAGTACTGTCGATGCTGGAGAAGCTTTTGGTGAAGAACAGAGATCTGAGTCCAAGAAAAGCAGCATCGCGGCCGAAGTGATTGCACAAGCACAGAAA AAGGCGGCCGAGCCAAGGACAACCATTGCATCCGAAGTCATTGCACAGGCACAGAAGGCGAAGCAATCGCCCGAGCAACAACAGTCGGAAGGATGGCAGG CGATTCCGAAACCAAAGGGACACTCGACGCTGAATTACAGGAGATGGGACAGGGTTGTGGTTGATGACTCTAGCGATGACGACGACGACGATGGAGAAGA GTGTCGGCCGCAGTATAGGTTCCGTGTTCGAACTGTTGGCGTGCAACCTGTAAAGTGA
AA sequence Show only first row Show all	>Lus10031195 pacid=23151083 polypeptide=Lus10031195 locus=Lus10031195.g ID=Lus10031195.BGIv1.0 annot-version=v1.0 MASSPQSPANKIESAHQLYRDGKYAVALGFYTEALSMMANTSPQKISLHSNRAACYLKLHDFKKAAEECTSVLELDQNHAGALMLRAQTLVTLKDYHSAL FDVNRLLELDPDSEVYQNLETRLRTQLSLASIPESEAELEEEDESESEDEQDGIEQTSNLEPDESRNESTVDAGEAFGEEQRSESKKSSIAAEVIAQAQK KAAEPRTTIASEVIAQAQKAKQSPEQQQSEGWQAIPKPKGHSTLNYRRWDRVVVDDSSDDDDDDGEECRPQYRFRVRTVGVQPVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G56090			Tetratricopeptide repeat (TPR)...		Lus10031195 [exp]	0	1
AT1G58030		CAT2	cationic amino acid transporte...		Lus10001334 [exp]	5.5	0.9521
AT1G13450	Trihelix	GT-1	GT-1, Homeodomain-like superfa...		Lus10015824 [exp]	11.0	0.9464
AT2G14680		MEE13	maternal effect embryo arrest ...		Lus10003821 [exp]	16.4	0.9439
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10033718 [exp]	17.2	0.9237
AT1G56090			Tetratricopeptide repeat (TPR)...		Lus10031774 [exp]	18.4	0.9419
AT3G24560		RSY3	RASPBERRY 3, Adenine nucleotid...		Lus10023647 [exp]	20.3	0.9150
AT5G53110			RING/U-box superfamily protein...		Lus10032382 [exp]	20.8	0.9416
AT1G21000			PLATZ transcription factor fam...		Lus10002700 [exp]	21.2	0.9444
AT1G13450	Trihelix	GT-1	GT-1, Homeodomain-like superfa...		Lus10036978 [exp]	21.6	0.9450
AT4G13400			2-oxoglutarate (2OG) and Fe(II...		Lus10033085 [exp]	24.0	0.9425

Compare expression of checked genes

Lus10031195 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.