Lus10031204 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031782 48 / 1e-07 AT2G32190 / unknown protein
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10031204 pacid=23151106 polypeptide=Lus10031204 locus=Lus10031204.g ID=Lus10031204.BGIv1.0 annot-version=v1.0
ATGGCTCACCACGACGATCACCCTGCTGCAGCTCATCCAGCATATCCACCACCGGGTCAGGCATATCCACCACCGGGTCAGGCGTACCCACCTCCTCAAG
GTTCGGAATACCCGCCACCGGGTCAAGCTTACCCACCACCACCACCGCCACAGTATCAGCCATACCCGCCGGTGCCGCCACCACAACAGGCAGCATACTA
CCCTCATAATCCACATGCTGCTGCTGCTCCACCGCCAGCCGGCTACCCACCGGTTCCGGCTGATCATGGACATCAGCCGCCGCCTGCTGCCAACACTCAA
AGTAAAGGAGATGGCTTCTTGAAAGGATGGCAAGTATACATTACACTCGCTGCTGCCATATGCTGCTGCTTTGCGTTCGAGGTCTGCTGCGACTGA
AA sequence
>Lus10031204 pacid=23151106 polypeptide=Lus10031204 locus=Lus10031204.g ID=Lus10031204.BGIv1.0 annot-version=v1.0
MAHHDDHPAAAHPAYPPPGQAYPPPGQAYPPPQGSEYPPPGQAYPPPPPPQYQPYPPVPPPQQAAYYPHNPHAAAAPPPAGYPPVPADHGHQPPPAANTQ
SKGDGFLKGWQVYITLAAAICCCFAFEVCCD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G32210 unknown protein Lus10031204 0 1
AT1G22710 SUT1, ATSUC2, S... SUCROSE TRANSPORTER 1, ARABIDO... Lus10007702 3.5 0.9027
AT3G44900 ATCHX4 cation/H+ exchanger 4, cation/... Lus10032622 4.9 0.8990
Lus10018215 5.9 0.8765
AT4G37650 GRAS SGR7, SHR SHORT ROOT, SHOOT GRAVITROPISM... Lus10025200 7.9 0.8737
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10014407 9.2 0.8738
Lus10025141 12.1 0.8839
Lus10025225 13.9 0.8771
Lus10041663 14.0 0.8495
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Lus10020492 15.1 0.8363
AT2G17030 F-box family protein with a do... Lus10013995 15.9 0.8204

Lus10031204 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.