Lus10031238 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G45140 226 / 1e-68 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
AT1G67560 159 / 1e-44 ATLOX6, LOX6 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
AT1G72520 149 / 6e-41 ATLOX4, LOX4 Arabidopsis thaliana lipoxygenase 4, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
AT1G17420 143 / 5e-39 ATLOX3, LOX3 Arabidopsis thaliana lipoxygenase 3, lipoxygenase 3 (.1)
AT1G55020 137 / 4e-37 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1)
AT3G22400 126 / 4e-33 ATLOX5, LOX5 Arabidopsis thaliana lipoxygenase 5, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031810 402 / 5e-135 AT3G45140 959 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Lus10031236 306 / 6e-99 AT3G45140 805 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Lus10039094 300 / 3e-96 AT3G45140 946 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Lus10002547 271 / 2e-85 AT3G45140 971 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Lus10041646 265 / 8e-83 AT3G45140 939 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Lus10031809 251 / 5e-79 AT3G45140 753 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Lus10002545 248 / 2e-75 AT3G45140 991 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Lus10027379 233 / 6e-72 AT1G72520 867 / 0.0 Arabidopsis thaliana lipoxygenase 4, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Lus10032087 196 / 6e-58 AT3G45140 894 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G046200 277 / 2e-87 AT3G45140 979 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Potri.001G015500 275 / 9e-87 AT3G45140 975 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Potri.001G015400 257 / 3e-80 AT3G45140 990 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Potri.009G022400 251 / 7e-78 AT3G45140 1008 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Potri.001G015300 232 / 9e-71 AT3G45140 943 / 0.0 ARABIODOPSIS THALIANA LIPOXYGENASE 2, lipoxygenase 2 (.1)
Potri.008G178000 179 / 2e-51 AT1G67560 1155 / 0.0 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Potri.010G057100 173 / 1e-49 AT1G67560 1144 / 0.0 Arabidopsis thaliana lipoxygenase 6, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
Potri.001G167700 163 / 7e-46 AT1G17420 1444 / 0.0 Arabidopsis thaliana lipoxygenase 3, lipoxygenase 3 (.1)
Potri.003G067600 148 / 4e-41 AT1G17420 1000 / 0.0 Arabidopsis thaliana lipoxygenase 3, lipoxygenase 3 (.1)
Potri.010G089500 129 / 3e-34 AT3G22400 1267 / 0.0 Arabidopsis thaliana lipoxygenase 5, PLAT/LH2 domain-containing lipoxygenase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00305 Lipoxygenase Lipoxygenase
Representative CDS sequence
>Lus10031238 pacid=23151134 polypeptide=Lus10031238 locus=Lus10031238.g ID=Lus10031238.BGIv1.0 annot-version=v1.0
ATGTTTTTTCTCCCGCTCAAATTTTTGGCAGATCCGAAATCGGAGTCGAGGAGCAGCGATTTCTACGTACCACGTGACGAGGAGTTCTCCGATGTGAAGC
AGTCGTCGTTTTCGTACAAGACGCTGTCGTCGGTACTGCGGGCGGTGATTCCCACGGTGGAGACGCTGTTCATCGATCCGGACCTTGGGTTTCCTAATTT
TACCGCCATTGATTCGTTGTTCGATCAAGGTCTCAACCTGCCTCCTCGCACCGCGGATTCGTCTTGGACGGACATCCTCCCCAGGCTCATTAGGTCCGTT
GCATCTCGCTCCAACGATGTCCTGCAGTTTGAGGTTCCTGAGGCTATGGAGAGGGACAGATTTTTCTGGCTGAAAGATGAGCAGTTTGGCAGGCAGACTC
TTGCTGGTGTTAATCCTTGTAGCATTGAGTTGGTCAAGGAATGGCCATTGAAGAGCAAGCTTGACCCGAATGTTTATGGTCCGCCAGAATCTGCAATCAC
CACTGAGATCGTTGAGAAGCAAATTAAAGGATTCATGACTGTTGATGAGGCTATGAAGCAAAAGAAGCTCTTCATCATAGACTACCATGATCTGCTGCTG
CCATTTGTGAACCTTGTGAGGAAGCTGGAAGGACTTGTCTCACACCGAGGAATGGCTATGGAAGCTAGCCAAAGCTCACGTCCTTGCACATGA
AA sequence
>Lus10031238 pacid=23151134 polypeptide=Lus10031238 locus=Lus10031238.g ID=Lus10031238.BGIv1.0 annot-version=v1.0
MFFLPLKFLADPKSESRSSDFYVPRDEEFSDVKQSSFSYKTLSSVLRAVIPTVETLFIDPDLGFPNFTAIDSLFDQGLNLPPRTADSSWTDILPRLIRSV
ASRSNDVLQFEVPEAMERDRFFWLKDEQFGRQTLAGVNPCSIELVKEWPLKSKLDPNVYGPPESAITTEIVEKQIKGFMTVDEAMKQKKLFIIDYHDLLL
PFVNLVRKLEGLVSHRGMAMEASQSSRPCT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10031238 0 1
AT3G45140 ATLOX2, LOX2 ARABIODOPSIS THALIANA LIPOXYGE... Lus10031237 1.4 0.9093
AT1G17420 ATLOX3, LOX3 Arabidopsis thaliana lipoxygen... Lus10031239 2.4 0.8823
AT2G27030 CAM5, CAM2, ACA... calmodulin 5 (.1.2.3) Lus10001775 8.3 0.8475
AT5G51160 Ankyrin repeat family protein ... Lus10034255 11.4 0.8080
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10024152 12.5 0.7686
AT1G01490 Heavy metal transport/detoxifi... Lus10024672 13.0 0.7442
AT2G44480 BGLU17 beta glucosidase 17 (.1.2) Lus10039513 13.3 0.7397
AT2G36760 UGT73C2 UDP-glucosyl transferase 73C2 ... Lus10014404 14.8 0.6926
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10006553 15.5 0.7597
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10038141 23.0 0.7876

Lus10031238 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.