Lus10031246 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G016100 38 / 0.0005 AT3G24225 39 / 4e-05 EMBRYO SURROUNDING REGION 19, CLAVATA3/ESR-RELATED 19 (.1)
PFAM info
Representative CDS sequence
>Lus10031246 pacid=23150997 polypeptide=Lus10031246 locus=Lus10031246.g ID=Lus10031246.BGIv1.0 annot-version=v1.0
ATGATCTCTGAATCAAAGTTGCTAACTTTCTTTGTGATATTGATGTCGATGGCTCGACATTGCACTTCCTTGTTTCTCGATCAGAAGATTGCAGGAGCAG
CAGGAAGATACATAGTCCAGAGGAGTCTGGTATCCTCGATGCTTATCTCGACTGTTGAGGATCTTCATGAACGAAACGTTCAATCTTACGCAAACATTCA
GCCAGAGACTCCGATTGAATTGCAGCGGATACAAAAATGGCCGTTCTGTTATTCGACTGATACTGGCAGTATGGTCTCACATGGGGTACCTGCAAATCTG
CAATTACTGTTGCTATATCTCATCATTACCTGCCACATGGCAGCTACTCCCCAGCCTTCGATTTGGCAAATCCGTACGAGGATACTAGCTAGCAGGAATC
CCAAGCTCACAGAATCAGGTTTGCAATCAGAAGATGGGAAATCTGTACAAGTTGGAAGACTCATAGCCAGAGGAGCCGCCAGGAAGGATCTTGGAGGGAA
AATGGCGATGGATTCTGCAAGGGAAGTGCCAACTGGGCCGGATCCGCTCCACCACCATAGCTATCCTTCAAGACCCTGA
AA sequence
>Lus10031246 pacid=23150997 polypeptide=Lus10031246 locus=Lus10031246.g ID=Lus10031246.BGIv1.0 annot-version=v1.0
MISESKLLTFFVILMSMARHCTSLFLDQKIAGAAGRYIVQRSLVSSMLISTVEDLHERNVQSYANIQPETPIELQRIQKWPFCYSTDTGSMVSHGVPANL
QLLLLYLIITCHMAATPQPSIWQIRTRILASRNPKLTESGLQSEDGKSVQVGRLIARGAARKDLGGKMAMDSAREVPTGPDPLHHHSYPSRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10031246 0 1
Lus10040920 5.5 0.8763
AT3G18820 RAB71, AtRABG3f... RAB GTPase homolog G3F (.1) Lus10042328 7.2 0.8778
AT3G09870 SAUR-like auxin-responsive pro... Lus10023011 15.5 0.8578
AT1G55680 Transducin/WD40 repeat-like su... Lus10037252 25.1 0.8595
AT4G13040 AP2_ERF Integrase-type DNA-binding sup... Lus10011836 28.3 0.8337
AT3G23880 F-box and associated interacti... Lus10036065 31.5 0.8498
AT5G16800 Acyl-CoA N-acyltransferases (N... Lus10013457 32.9 0.8571
AT5G22300 AtNIT4, NIT4 nitrilase 4 (.1) Lus10016999 33.0 0.8604
AT3G14075 Mono-/di-acylglycerol lipase, ... Lus10015680 35.3 0.8601
AT3G61800 unknown protein Lus10004000 37.9 0.8535

Lus10031246 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.