Lus10031250 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
AT5G10390 271 / 1e-95 Histone superfamily protein (.1)
AT3G27360 271 / 1e-95 Histone superfamily protein (.1)
AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
AT4G40040 265 / 3e-93 Histone superfamily protein (.1.2)
AT4G40030 265 / 3e-93 Histone superfamily protein (.1.2.3)
AT5G10980 265 / 3e-93 Histone superfamily protein (.1)
AT5G65350 260 / 3e-91 HTR11 histone 3 11 (.1)
AT1G75600 256 / 1e-89 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031822 272 / 5e-96 AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
Lus10005271 272 / 5e-96 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10005270 272 / 5e-96 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10025439 272 / 5e-96 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Lus10012744 272 / 6e-96 AT5G65360 271 / 2e-95 Histone superfamily protein (.1)
Lus10031821 274 / 8e-96 AT3G27360 273 / 3e-95 Histone superfamily protein (.1)
Lus10013948 273 / 2e-95 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
Lus10031252 270 / 5e-95 AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
Lus10012757 220 / 1e-75 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G233900 272 / 4e-96 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Potri.014G096900 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.002G028800 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G210100 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207852 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207700 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016700 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016900 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.007G096700 265 / 3e-93 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G014300 265 / 3e-93 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10031250 pacid=23151054 polypeptide=Lus10031250 locus=Lus10031250.g ID=Lus10031250.BGIv1.0 annot-version=v1.0
ATGGCTCGTACCAAGCAGACGGCAAGGAAATCCACGGGAGGAAAGGCGCCAAGGAAGCAGCTGGCTACGAAGGCCGCTCGGAAATCTGCTCCGGCTACCG
GAGGAGTGAAGAAGCCTCACAGATTCAGGCCAGGAACCGTCGCGCTCAGGGAGATTAGGAAGTACCAGAAGAGCACTGAGCTTCTCATCAGGAAGCTCCC
GTTCCAGAGGCTGGTGAGGGAAATCGCTCAGGATTTCAAGACGGATCTCAGGTTCCAGAGCAGCGCCGTCTCTGCTCTCCAGGAGGCTGCCGAGGCTTAT
CTCGTTGGATTGTTCGAGGATACCAATCTCTGCGCCATCCATGCTAAGAGGGTCACCATTATGCCCAAGGATATCCAGCTCGCCAGGAGGATCAGAGGCG
AGCGAGCTTAG
AA sequence
>Lus10031250 pacid=23151054 polypeptide=Lus10031250 locus=Lus10031250.g ID=Lus10031250.BGIv1.0 annot-version=v1.0
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09200 Histone superfamily protein (.... Lus10031250 0 1
AT5G65360 Histone superfamily protein (.... Lus10012744 1.4 0.9576
AT3G27360 Histone superfamily protein (.... Lus10031821 2.4 0.9560
AT5G23420 HMGB6 high-mobility group box 6 (.1.... Lus10013453 3.5 0.9502
AT4G01270 RING/U-box superfamily protein... Lus10018817 3.9 0.9434
AT2G29570 ATPCNA2, PCNA2 A. THALIANA PROLIFERATING CELL... Lus10005874 4.0 0.9501
AT1G75150 unknown protein Lus10010814 4.2 0.9434
AT5G52800 DNA primases (.1.2.3) Lus10038837 4.9 0.9325
AT5G23420 HMGB6 high-mobility group box 6 (.1.... Lus10041009 5.3 0.9407
AT1G69400 Transducin/WD40 repeat-like su... Lus10014343 6.7 0.9180
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10016156 8.7 0.9142

Lus10031250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.