Lus10031252 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65360 268 / 2e-94 Histone superfamily protein (.1)
AT5G10400 268 / 2e-94 Histone superfamily protein (.1)
AT5G10390 268 / 2e-94 Histone superfamily protein (.1)
AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
AT1G09200 268 / 2e-94 Histone superfamily protein (.1)
AT4G40040 262 / 5e-92 Histone superfamily protein (.1.2)
AT4G40030 262 / 5e-92 Histone superfamily protein (.1.2.3)
AT5G10980 262 / 5e-92 Histone superfamily protein (.1)
AT5G65350 257 / 6e-90 HTR11 histone 3 11 (.1)
AT1G75600 254 / 5e-89 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031822 270 / 5e-95 AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
Lus10005271 270 / 5e-95 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10005270 270 / 5e-95 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10031250 270 / 5e-95 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10025439 270 / 5e-95 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Lus10012744 269 / 1e-94 AT5G65360 271 / 2e-95 Histone superfamily protein (.1)
Lus10031821 271 / 2e-94 AT3G27360 273 / 3e-95 Histone superfamily protein (.1)
Lus10013948 270 / 3e-94 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
Lus10012757 218 / 1e-74 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G233900 270 / 4e-95 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Potri.014G096900 268 / 2e-94 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.002G028800 268 / 2e-94 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G210100 268 / 2e-94 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207852 268 / 2e-94 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207700 268 / 2e-94 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016700 268 / 2e-94 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016900 268 / 2e-94 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.007G096700 262 / 5e-92 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G014300 262 / 5e-92 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10031252 pacid=23151123 polypeptide=Lus10031252 locus=Lus10031252.g ID=Lus10031252.BGIv1.0 annot-version=v1.0
ATGGCTCGTACCAAGCAGACGGCAAGGAAGTCCACCGGAGGAAAGGCGCCAAGGAAGCAGCTGGCGACGAAGGCTGCTCGCAAGTCAGCTCCGGCGACCG
GAGGGGTGAAGAAGCCACACAGATTCAGGCCAGGAACCGTCGCTCTGAGGGAGATCAGGAAGTACCAGAAGAGTACTGAGCTGCTCATCAGGAAGCTCCC
CTTCCAGAGGCTGGTGAGGGAAATCGCCCAGGATTCCAAGACCGATCTGAGGTTCCAGAGCAGCGCCGTCTCTGCTCTCCAGGAGGCTGCCGAAGCTTAT
CTTGTTGGATTGTTCGAGGACACTAACCTCTGCGCTATTCACGCCAAGAGGGTGACGATTATGCCCAAGGATATCCAGCTTGCTAGGAGGATCAGGGGTG
AGAGAGCTTAG
AA sequence
>Lus10031252 pacid=23151123 polypeptide=Lus10031252 locus=Lus10031252.g ID=Lus10031252.BGIv1.0 annot-version=v1.0
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDSKTDLRFQSSAVSALQEAAEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G27360 Histone superfamily protein (.... Lus10031252 0 1
AT5G10400 Histone superfamily protein (.... Lus10031822 1.7 0.9787
AT2G28740 HIS4 histone H4 (.1) Lus10025964 2.0 0.9716
AT5G49170 unknown protein Lus10022872 3.5 0.9156
AT5G59970 Histone superfamily protein (.... Lus10041919 4.9 0.9483
AT4G40030 Histone superfamily protein (.... Lus10013946 5.0 0.9470
AT1G20580 Small nuclear ribonucleoprotei... Lus10012263 5.1 0.8919
AT2G27970 CKS2 CDK-subunit 2 (.1) Lus10016159 5.1 0.9149
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10040853 5.7 0.9603
AT3G53730 Histone superfamily protein (.... Lus10023331 7.0 0.9427
AT3G46320 Histone superfamily protein (.... Lus10019956 7.1 0.9314

Lus10031252 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.