Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51790 145 / 1e-44 ATG1 transmembrane protein G1P-related 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031835 [exp] 200 / 5e-66 AT3G51790 306 / 2e-105 transmembrane protein G1P-related 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G205200 [exp] 134 / 2e-40 AT3G51790 306 / 2e-105 transmembrane protein G1P-related 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0021 [flax] [poplar] OB PF03100 [flax] [poplar] CcmE CcmE
Representative CDS sequence Show only first row Show all	>Lus10031266 pacid=23150961 polypeptide=Lus10031266 locus=Lus10031266.g ID=Lus10031266.BGIv1.0 annot-version=v1.0 ATGTCGTCGCCGGAGACGGAGTTCGTGGTGACGGATTTGATCACCGATATCATGGTGAGGTTCAAAGGCGCGTTGCCTGACTTGTTCAGAGAAGGGCATT CGGTTGTAGTGGAAGGATTTGTGAGGCCGATGACTGAGGAGTTGAAGAATGAAACGGGTAGCAAGAGTGTTTCGGAGAAGGCTAGGAGTTCAGATGTTTT CTTTTCTGCTACAGAGGTTTTAGCTAAGCACGATGAGAAGTACATGCCTCAGGAGGTTGCAGCTGCCATTGAGAAGAACAAGAAGAAGCTAGAAGAAGAA GGAGAAGATGCTGGGAAAACTGAGAAGAAAGTGACCAAATAG
AA sequence Show only first row Show all	>Lus10031266 pacid=23150961 polypeptide=Lus10031266 locus=Lus10031266.g ID=Lus10031266.BGIv1.0 annot-version=v1.0 MSSPETEFVVTDLITDIMVRFKGALPDLFREGHSVVVEGFVRPMTEELKNETGSKSVSEKARSSDVFFSATEVLAKHDEKYMPQEVAAAIEKNKKKLEEE GEDAGKTEKKVTK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51790		ATG1	transmembrane protein G1P-rela...		Lus10031266 [exp]	0	1
AT1G14360		ATUTR3, UTR3	UDP-galactose transporter 3 (....		Lus10012848 [exp]	2.0	0.8847
AT5G25500			unknown protein		Lus10002031 [exp]	2.4	0.9022
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10017431 [exp]	3.9	0.8835
AT1G62730			Terpenoid synthases superfamil...		Lus10032248 [exp]	4.0	0.8653
AT2G33410			RNA-binding (RRM/RBD/RNP motif...		Lus10043124 [exp]	5.5	0.8724
AT2G41080			Tetratricopeptide repeat (TPR)...		Lus10003325 [exp]	6.0	0.8706
AT5G43400			Uncharacterised conserved prot...		Lus10013399 [exp]	6.6	0.8460
AT2G26690			Major facilitator superfamily ...		Lus10018553 [exp]	6.9	0.8728
AT1G06475			unknown protein		Lus10015269 [exp]	7.0	0.8656
AT3G51790		ATG1	transmembrane protein G1P-rela...		Lus10031835 [exp]	8.1	0.8450

Compare expression of checked genes

Lus10031266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.