Lus10031267 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51790 128 / 2e-37 ATG1 transmembrane protein G1P-related 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031835 255 / 4e-87 AT3G51790 306 / 2e-105 transmembrane protein G1P-related 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G205200 145 / 4e-44 AT3G51790 306 / 2e-105 transmembrane protein G1P-related 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF03100 CcmE CcmE
Representative CDS sequence
>Lus10031267 pacid=23151003 polypeptide=Lus10031267 locus=Lus10031267.g ID=Lus10031267.BGIv1.0 annot-version=v1.0
ATGGCATCTCGCTCCTTCCTCCACCGTATCAGATCTCAGCTTCTCCGCTCCTCGACTACCTCCACCGCAGCTGCTGGATCCTGGCCTGGAATCTTCCTTT
CCACTCGCCAGCTCACATCCAAACGGATGATTCTCTCTCCAGTTTCAGATCTCCGCTCAGCTTACACCGACTCGACTTCGATCTCCGGGATACGGTTCTT
CTCCACTGCGCGCCGCCATCCGTCGCGGCCGAAGGCCGTGGACATAGGAGCTCGAGCTCGTCAACTGCAGACCAGGCGACTCTGGACGTACGCGCTCGCC
TTCAGCGGCGTGGCCGGTTTCATAGTCATCGTTCTGAACAATTTCCAGGACCAGATGGTGTTCTACGTGACTCCGAGCGACGCGATTGAGCAGTACAGGG
CGAATCCGAAGAAGACGAAGTTCAGATTGCAAAGAAGCTGA
AA sequence
>Lus10031267 pacid=23151003 polypeptide=Lus10031267 locus=Lus10031267.g ID=Lus10031267.BGIv1.0 annot-version=v1.0
MASRSFLHRIRSQLLRSSTTSTAAAGSWPGIFLSTRQLTSKRMILSPVSDLRSAYTDSTSISGIRFFSTARRHPSRPKAVDIGARARQLQTRRLWTYALA
FSGVAGFIVIVLNNFQDQMVFYVTPSDAIEQYRANPKKTKFRLQRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G51790 ATG1 transmembrane protein G1P-rela... Lus10031267 0 1
AT3G51790 ATG1 transmembrane protein G1P-rela... Lus10031835 2.4 0.8428
AT1G77405 Pentatricopeptide repeat (PPR)... Lus10042736 7.6 0.8089
AT5G16220 Octicosapeptide/Phox/Bem1p fam... Lus10017612 15.5 0.7553
AT3G13110 SAT-M, SAT-A, S... SERINE ACETYLTRANSFERASE 3, SE... Lus10040503 17.4 0.7753
AT4G10040 CYTC-2 cytochrome c-2 (.1) Lus10008922 20.4 0.7807
AT1G04980 ATPDI10, ATPDIL... ARABIDOPSIS THALIANA PROTEIN D... Lus10031522 30.1 0.7546
AT2G37250 ADK, ATPADK1 adenosine kinase (.1) Lus10040358 33.8 0.7455
AT3G57400 unknown protein Lus10042067 37.0 0.7340
AT5G16220 Octicosapeptide/Phox/Bem1p fam... Lus10033570 37.8 0.7179
AT5G19180 ECR1 E1 C-terminal related 1 (.1) Lus10034043 38.4 0.7518

Lus10031267 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.