Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15200 102 / 7e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G15010 56 / 4e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G22470 54 / 2e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G27270 49 / 8e-08 EMB976 EMBRYO DEFECTIVE 976, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G25210 46 / 9e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G41170 44 / 4e-06 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G18900 44 / 6e-06 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2), Pentatricopeptide repeat (PPR) superfamily protein (.3) AT4G31850 43 / 1e-05 PGR3 proton gradient regulation 3 (.1) AT4G38150 42 / 2e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1), Pentatricopeptide repeat (PPR) superfamily protein (.2) AT4G01570 42 / 2e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031837 [exp] 201 / 1e-63 AT3G15200 499 / 2e-173 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021991 [exp] 57 / 1e-10 AT5G15010 617 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039021 [exp] 56 / 5e-10 AT3G49730 215 / 5e-62 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10038215 [exp] 54 / 1e-09 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10025890 [exp] 49 / 1e-07 AT3G25210 430 / 6e-151 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015110 [exp] 46 / 7e-07 AT1G09900 347 / 1e-112 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10003424 [exp] 46 / 8e-07 AT4G31850 1373 / 0.0 proton gradient regulation 3 (.1) Lus10018394 [exp] 46 / 1e-06 AT3G13160 327 / 8e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10007619 [exp] 45 / 2e-06 AT3G13160 341 / 2e-115 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G115500 [exp] 106 / 5e-28 AT3G15200 546 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G053600 [exp] 61 / 6e-12 AT5G15010 659 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G066700 [exp] 56 / 3e-10 AT1G20300 213 / 5e-62 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G123900 [exp] 47 / 3e-07 AT3G18110 1974 / 0.0 embryo defective 1270, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G068400 [exp] 46 / 7e-07 AT3G22470 300 / 8e-96 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G114700 [exp] 46 / 7e-07 AT1G71060 679 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.019G049400 [exp] 45 / 2e-06 AT5G27270 1179 / 0.0 EMBRYO DEFECTIVE 976, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G180000 [exp] 45 / 2e-06 AT3G16010 950 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.006G264800 [exp] 45 / 2e-06 AT4G31850 1428 / 0.0 proton gradient regulation 3 (.1) Potri.011G032400 [exp] 44 / 3e-06 AT3G13160 343 / 4e-116 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10031269 pacid=23150963 polypeptide=Lus10031269 locus=Lus10031269.g ID=Lus10031269.BGIv1.0 annot-version=v1.0 ATGTTGAAGATGTATGTGAGTTGGGACTGTGAGGAGAAAGTGAGGGAGATGTGGTGCGAGATGGAGAACAAGGGTTTGGGACCGGATCAACGGTCTTACT CGATAATGGTACACTGGTTATATGAGAAGAGGAGATTCGATGATGCTTTGCGTTACTATCGGGAGATGAAGTCGAAGGGGATGGTTCCGGAACCGCAGAC TGAAATGCTGGTCTGTTCGATGTCTACCAAGGATGCGGAGAACAAGATGATACAGAAGATGCCAAGCGATAGGCGGAACAAACTATCCGTTAAGAGAATT ATCGAAAGGAAAGGGGTGATCTAA
AA sequence Show only first row Show all	>Lus10031269 pacid=23150963 polypeptide=Lus10031269 locus=Lus10031269.g ID=Lus10031269.BGIv1.0 annot-version=v1.0 MLKMYVSWDCEEKVREMWCEMENKGLGPDQRSYSIMVHWLYEKRRFDDALRYYREMKSKGMVPEPQTEMLVCSMSTKDAENKMIQKMPSDRRNKLSVKRI IERKGVI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031269 [exp]	0	1
AT4G26120			Ankyrin repeat family protein ...		Lus10024843 [exp]	2.2	0.8318
AT1G11270			F-box and associated interacti...		Lus10025893 [exp]	3.0	0.8587
AT5G27530			Pectin lyase-like superfamily ...		Lus10036205 [exp]	4.9	0.8493
AT1G59950			NAD(P)-linked oxidoreductase s...		Lus10039266 [exp]	5.1	0.8559
AT5G61280			Remorin family protein (.1)		Lus10034714 [exp]	6.9	0.8373
AT5G49810		MMT	methionine S-methyltransferase...		Lus10038132 [exp]	7.9	0.7942
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10031752 [exp]	11.5	0.7703
AT1G27340			Galactose oxidase/kelch repeat...		Lus10003117 [exp]	12.7	0.8084
AT1G19780		ATCNGC8	cyclic nucleotide gated channe...		Lus10041662 [exp]	14.2	0.7503
AT2G16280		KCS9	3-ketoacyl-CoA synthase 9 (.1)		Lus10040578 [exp]	17.9	0.7797

Compare expression of checked genes

Lus10031269 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.