Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15200 115 / 3e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G15010 60 / 1e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G77340 60 / 2e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G65560 59 / 2e-11 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G07740 57 / 1e-10 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63070 56 / 6e-10 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G63400 54 / 1e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53700 54 / 2e-09 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G80550 54 / 3e-09 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G20090 54 / 3e-09 EMB1025 embryo defective 1025, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031837 [exp] 189 / 1e-58 AT3G15200 499 / 2e-173 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003446 [exp] 63 / 4e-13 AT1G62930 137 / 2e-37 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014245 [exp] 59 / 4e-11 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014242 [exp] 59 / 4e-11 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014247 [exp] 59 / 4e-11 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10003433 [exp] 59 / 5e-11 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003447 [exp] 58 / 6e-11 AT1G12700 202 / 1e-56 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014244 [exp] 58 / 6e-11 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10022861 [exp] 57 / 1e-10 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G115500 [exp] 138 / 1e-39 AT3G15200 546 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242200 [exp] 66 / 7e-14 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271200 [exp] 64 / 4e-13 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G149800 [exp] 62 / 4e-12 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.019G021200 [exp] 59 / 2e-11 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050300 [exp] 59 / 2e-11 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G038400 [exp] 59 / 3e-11 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G257300 [exp] 59 / 4e-11 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050400 [exp] 58 / 6e-11 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050180 [exp] 58 / 7e-11 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10031270 pacid=23151101 polypeptide=Lus10031270 locus=Lus10031270.g ID=Lus10031270.BGIv1.0 annot-version=v1.0 ATGGTTGGTCATGACATCAAGACTCTGAATATCGTTCTCAATGGTTGGTGTGTTCTTGGGAACGTACGAGAGGCGAAGAGATTCTGGAAAGATATAGTTA CGTCGAAATGCAAGCCGAATTTGTTTACCTATGTGGCGTTCATCAATGCGTTAACCAAAAAGGGGAAGCTCGGCACTGCACTGAAGCTGTACGGTGCAAT GCGGAAGAAGAACGAATGCAAACCGGACGTGGTGATCTGCAACTGTGTTATTGATGCTCTTTGTTTGAAGAAGACGATCCCTGAAACATTGGAAATTTTC AGAGAAATGAATGATGATGATGGAGTGTGTTCTCCGAATGTGGCGAGTTAG
AA sequence Show only first row Show all	>Lus10031270 pacid=23151101 polypeptide=Lus10031270 locus=Lus10031270.g ID=Lus10031270.BGIv1.0 annot-version=v1.0 MVGHDIKTLNIVLNGWCVLGNVREAKRFWKDIVTSKCKPNLFTYVAFINALTKKGKLGTALKLYGAMRKKNECKPDVVICNCVIDALCLKKTIPETLEIF REMNDDDGVCSPNVAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031270 [exp]	0	1
AT5G45275			Major facilitator superfamily ...		Lus10033280 [exp]	2.2	0.9477
AT3G24530			AAA-type ATPase family protein...		Lus10005293 [exp]	3.5	0.9253
AT5G17680			disease resistance protein (TI...		Lus10010221 [exp]	4.5	0.9108
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10004652 [exp]	6.9	0.9321
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Lus10030134 [exp]	8.0	0.9215
AT1G64760			O-Glycosyl hydrolases family 1...		Lus10020526 [exp]	9.3	0.8618
AT5G24670		TAD3, EMB2820	tRNA adenosine deaminase 3, EM...		Lus10040753 [exp]	11.0	0.8850
AT2G04220			Plant protein of unknown funct...		Lus10032896 [exp]	11.4	0.8860
AT4G11170			Disease resistance protein (TI...		Lus10010222 [exp]	16.3	0.8714
AT1G02550			Plant invertase/pectin methyle...		Lus10039849 [exp]	16.6	0.8653

Compare expression of checked genes

Lus10031270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.