Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30130 226 / 3e-76 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT1G16530 169 / 5e-54 AS2 ASL9, LBD3 LOB DOMAIN-CONTAINING PROTEIN 3, ASYMMETRIC LEAVES 2-like 9 (.1) AT1G31320 162 / 2e-51 AS2 LBD4 LOB domain-containing protein 4 (.1) AT1G07900 160 / 3e-50 AS2 LBD1 LOB domain-containing protein 1 (.1) AT2G28500 160 / 7e-50 AS2 LBD11 LOB domain-containing protein 11 (.1) AT5G63090 153 / 1e-47 AS2 LOBB, LOB Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT2G30340 152 / 4e-46 AS2 LBD13 LOB domain-containing protein 13 (.1) AT3G27650 147 / 9e-46 AS2 LBD25 LOB domain-containing protein 25 (.1) AT3G26620 142 / 2e-44 AS2 LBD23 LOB domain-containing protein 23 (.1) AT3G26660 142 / 2e-44 AS2 LBD24 LOB domain-containing protein 24 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031855 [exp] 330 / 1e-117 AT2G30130 220 / 4e-74 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10007525 [exp] 210 / 4e-70 AT2G30130 204 / 1e-67 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10017431 [exp] 200 / 2e-66 AT2G30130 199 / 1e-65 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10040638 [exp] 182 / 4e-59 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1) Lus10018275 [exp] 182 / 7e-59 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10031191 [exp] 179 / 2e-58 AT1G31320 199 / 2e-66 LOB domain-containing protein 4 (.1) Lus10031769 [exp] 177 / 2e-57 AT1G31320 193 / 8e-64 LOB domain-containing protein 4 (.1) Lus10011645 [exp] 159 / 2e-49 AT2G28500 205 / 4e-67 LOB domain-containing protein 11 (.1) Lus10040373 [exp] 158 / 6e-49 AT2G28500 211 / 7e-69 LOB domain-containing protein 11 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G281600 [exp] 252 / 8e-87 AT2G30130 248 / 4e-85 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.009G076900 [exp] 243 / 4e-83 AT2G30130 228 / 2e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.010G184400 [exp] 242 / 8e-83 AT2G30130 227 / 7e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.008G072800 [exp] 239 / 6e-82 AT2G30130 229 / 8e-78 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.005G097800 [exp] 184 / 2e-60 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.007G066700 [exp] 182 / 1e-59 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.001G081400 [exp] 182 / 3e-59 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1) Potri.003G149000 [exp] 182 / 3e-59 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1) Potri.008G043900 [exp] 161 / 2e-50 AT1G07900 218 / 2e-72 LOB domain-containing protein 1 (.1) Potri.010G217700 [exp] 160 / 6e-50 AT1G07900 203 / 1e-66 LOB domain-containing protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10031285 pacid=23150944 polypeptide=Lus10031285 locus=Lus10031285.g ID=Lus10031285.BGIv1.0 annot-version=v1.0 ATGGGAGGCACTTCACCTTGCGCATCTTGCAAGCTCCTAAGGCGCCGCTGCGCCAAAGACTGCATCTTCGCCCCTTACTTCCCCTCCGACGACCCCCACA AGTTCGCCATCGTTCACAAGGTCTTCGGTGCCAGCAACGTCAGCAAGATGCTGCAGGAGATCCCGGTGCAACAGAGGGCAGACGCGGTAAGCAGCCTAGT GTACGAGGCAAACGCGAGAGTTCGAGACCCGGTGTATGGATGCGTGGGGGCGATATCGTTCCTCCAGAACCAAGTGTCCCAGCTTCAAATGCAGCTAGCC GTGGCACAAGCCGAGATACTTTGCATCCAGATGCAGCATCAAGACCCGGTATCGTCGGCATCAGCATCAACCTTCCCAAACCCTAATGATCTACTAGATC ATAGCCAGCATCATCATGAAATGGTGGATAGTAAATCCCTTCTCTTGGCAAGCTATGGCCTTAACTTCTCTTCTTCAGGTGCTACCAATACTGTAATCCA AGACCCTCTCAAGAGAGAGTCCCTTTGGACTTAG
AA sequence Show only first row Show all	>Lus10031285 pacid=23150944 polypeptide=Lus10031285 locus=Lus10031285.g ID=Lus10031285.BGIv1.0 annot-version=v1.0 MGGTSPCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQEIPVQQRADAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQMQLA VAQAEILCIQMQHQDPVSSASASTFPNPNDLLDHSQHHHEMVDSKSLLLASYGLNFSSSGATNTVIQDPLKRESLWT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10031285 [exp]	0	1
AT5G39820	NAC	ANAC094	NAC domain containing protein ...		Lus10030478 [exp]	1.0	0.9472
AT2G12646			PLATZ transcription factor fam...		Lus10008814 [exp]	5.5	0.9402
AT3G10120			unknown protein		Lus10027167 [exp]	5.7	0.9319
AT2G12646			PLATZ transcription factor fam...		Lus10039989 [exp]	7.4	0.9193
AT2G41810			Protein of unknown function, D...		Lus10031067 [exp]	7.5	0.9148
AT3G20840	AP2_ERF	PLT1	PLETHORA 1, Integrase-type DNA...		Lus10031831 [exp]	7.7	0.9181
AT3G07620			Exostosin family protein (.1)		Lus10008751 [exp]	9.5	0.9107
AT5G19640			Major facilitator superfamily ...		Lus10039204 [exp]	9.9	0.8571
AT1G77330			2-oxoglutarate (2OG) and Fe(II...		Lus10000857 [exp]	10.4	0.9138
AT5G14920			Gibberellin-regulated family p...		Lus10032168 [exp]	11.7	0.9268

Compare expression of checked genes

Lus10031285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.