Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09280 236 / 2e-79 Pectin lyase-like superfamily protein (.1) AT1G30350 158 / 2e-48 Pectin lyase-like superfamily protein (.1) AT4G22090 155 / 7e-47 Pectin lyase-like superfamily protein (.1) AT4G22080 154 / 2e-46 RHS14 root hair specific 14 (.1) AT1G11920 152 / 1e-45 Pectin lyase-like superfamily protein (.1) AT3G24230 150 / 3e-44 Pectate lyase family protein (.1) AT3G24670 145 / 2e-42 Pectin lyase-like superfamily protein (.1) AT5G04310 145 / 3e-42 Pectin lyase-like superfamily protein (.1) AT4G13210 143 / 3e-42 Pectin lyase-like superfamily protein (.1.2) AT1G67750 143 / 4e-42 Pectate lyase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031867 [exp] 257 / 3e-88 AT5G09280 277 / 1e-93 Pectin lyase-like superfamily protein (.1) Lus10042509 [exp] 147 / 9e-46 AT4G13710 367 / 3e-127 Pectin lyase-like superfamily protein (.1.2) Lus10011258 [exp] 150 / 1e-44 AT1G11920 549 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10011257 [exp] 149 / 2e-44 AT1G11920 530 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10018430 [exp] 149 / 2e-44 AT1G11920 525 / 0.0 Pectin lyase-like superfamily protein (.1) Lus10013668 [exp] 146 / 2e-44 AT5G63180 424 / 2e-149 Pectin lyase-like superfamily protein (.1) Lus10018429 [exp] 150 / 3e-44 AT1G11920 437 / 8e-152 Pectin lyase-like superfamily protein (.1) Lus10013667 [exp] 144 / 9e-44 AT5G63180 469 / 4e-167 Pectin lyase-like superfamily protein (.1) Lus10011400 [exp] 145 / 6e-43 AT1G67750 623 / 0.0 Pectate lyase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G007400 [exp] 237 / 3e-79 AT5G09280 416 / 2e-146 Pectin lyase-like superfamily protein (.1) Potri.003G218200 [exp] 235 / 5e-78 AT5G09280 414 / 2e-145 Pectin lyase-like superfamily protein (.1) Potri.004G007300 [exp] 157 / 2e-47 AT4G22080 489 / 1e-173 root hair specific 14 (.1) Potri.011G008100 [exp] 153 / 4e-46 AT4G22080 504 / 2e-179 root hair specific 14 (.1) Potri.011G008000 [exp] 152 / 7e-46 AT4G22080 540 / 0.0 root hair specific 14 (.1) Potri.014G178100 [exp] 146 / 6e-43 AT3G07010 652 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.015G087800 [exp] 145 / 7e-43 AT5G63180 657 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.001G339500 [exp] 144 / 2e-42 AT4G24780 617 / 0.0 Pectin lyase-like superfamily protein (.1.2) Potri.011G093400 [exp] 144 / 2e-42 AT5G63180 509 / 0.0 Pectin lyase-like superfamily protein (.1) Potri.012G091500 [exp] 144 / 3e-42 AT4G24780 645 / 0.0 Pectin lyase-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF00544 [flax] [poplar] Pectate_lyase_4 Pectate lyase
Representative CDS sequence Show only first row Show all	>Lus10031296 pacid=23151075 polypeptide=Lus10031296 locus=Lus10031296.g ID=Lus10031296.BGIv1.0 annot-version=v1.0 ATGGACGGAGACGCCGTCAGATTGGTGACGGCCCACAAAGTTCGGATAGACCACAACACACTCTACTCTTGCCAAGATGGTTTGCTCGACGTGACCCGTG GTTCGACCGATGTGACCGTTTTCAACAACTGGTTTAGAAACCAAGACAAGGTCATGCTCCTAGGCCATGATGACGGCTATGTTCGAGACAAGGGTATGAA GGTCACGGTTCTGCTGAACCATTTTGGCCCGAATTGTAACCAACGCATGCCAAGGGTTCGACATGGATATGCACATGTTGCCAACAACTTGTACCAAGGA TGGACACAATATGCAATTGGTGGAAGCATGAACCCTAGCATCAAGAGTGAGTCTAATTACTTTATTGCCCCTACCGGAAGAAAAGAGTGA
AA sequence Show only first row Show all	>Lus10031296 pacid=23151075 polypeptide=Lus10031296 locus=Lus10031296.g ID=Lus10031296.BGIv1.0 annot-version=v1.0 MDGDAVRLVTAHKVRIDHNTLYSCQDGLLDVTRGSTDVTVFNNWFRNQDKVMLLGHDDGYVRDKGMKVTVLLNHFGPNCNQRMPRVRHGYAHVANNLYQG WTQYAIGGSMNPSIKSESNYFIAPTGRKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09280			Pectin lyase-like superfamily ...		Lus10031296 [exp]	0	1

Compare expression of checked genes

Lus10031296 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.