Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016047 [exp] 45 / 2e-06 AT1G20950 1075 / 0.0 Phosphofructokinase family protein (.1) Lus10025167 [exp] 45 / 2e-06 AT1G20950 1075 / 0.0 Phosphofructokinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G024500 [exp] 56 / 3e-11 AT1G20950 67 / 5e-14 Phosphofructokinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031302 pacid=23151126 polypeptide=Lus10031302 locus=Lus10031302.g ID=Lus10031302.BGIv1.0 annot-version=v1.0 ATGGATCGCAGCGCTCCTCCTTCTGCAATCAACTCTCGCTCTGCAACTGCAGCAGCTGCTGTTAGTACAAGCTCCATTGATTTGGAACTTGAAGACCAAA ATCAAGAAGAACAAATCCGGGGGATAGAAGAGCTTCACAATTACCTTGACAAGGTAAAGGAGATGGTACTGAGACCTGGTTGCCCACCACAGATACTGAA AGTAGCTCTAGATTCGTTGTCCTCGCTTTCCAAAACCTTGGCCTCCATGTCAGAGCCAAATCCTAAGCTGCTGCTTTCCTCATTATGA
AA sequence Show only first row Show all	>Lus10031302 pacid=23151126 polypeptide=Lus10031302 locus=Lus10031302.g ID=Lus10031302.BGIv1.0 annot-version=v1.0 MDRSAPPSAINSRSATAAAAVSTSSIDLELEDQNQEEQIRGIEELHNYLDKVKEMVLRPGCPPQILKVALDSLSSLSKTLASMSEPNPKLLLSSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10031302 [exp]	0	1
AT1G22800			S-adenosyl-L-methionine-depend...		Lus10018987 [exp]	12.8	0.8600
AT2G39970		PXN, PMP38, APE...	peroxisomal NAD carrier, perox...		Lus10009886 [exp]	20.7	0.8384
AT4G25180			RNA polymerase III RPC4 (.1)		Lus10009019 [exp]	23.2	0.8273
AT2G39970		PXN, PMP38, APE...	peroxisomal NAD carrier, perox...		Lus10014839 [exp]	25.1	0.8347
AT5G12230		MED19A	unknown protein		Lus10002150 [exp]	26.6	0.8527
AT1G49180			protein kinase family protein ...		Lus10033518 [exp]	30.4	0.8498
AT4G10050			esterase/lipase/thioesterase f...		Lus10041054 [exp]	33.8	0.8390
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10042725 [exp]	38.0	0.8496
AT1G12680		PEPKR2	phosphoenolpyruvate carboxylas...		Lus10036464 [exp]	40.0	0.8436
AT4G02570		AXR6, ATCUL1	AUXIN RESISTANT 6, cullin 1 (....		Lus10032200 [exp]	42.0	0.8415

Compare expression of checked genes

Lus10031302 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.