Lus10031327 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38290 240 / 2e-81 Peptidyl-tRNA hydrolase family protein (.1.2)
AT5G16140 237 / 3e-80 Peptidyl-tRNA hydrolase family protein (.1.2)
AT5G19830 174 / 7e-56 Peptidyl-tRNA hydrolase family protein (.1)
AT1G18440 160 / 2e-49 Peptidyl-tRNA hydrolase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031901 300 / 6e-105 AT5G16140 333 / 1e-116 Peptidyl-tRNA hydrolase family protein (.1.2)
Lus10014589 178 / 6e-57 AT5G19830 316 / 2e-110 Peptidyl-tRNA hydrolase family protein (.1)
Lus10042977 162 / 7e-51 AT1G18440 345 / 6e-121 Peptidyl-tRNA hydrolase family protein (.1)
Lus10032093 167 / 2e-50 AT3G27460 282 / 8e-93 SaGa associated Factor 29 a, SGF29 tudor-like domain (.1.2)
Lus10032480 150 / 1e-45 AT1G18440 332 / 5e-115 Peptidyl-tRNA hydrolase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G098100 275 / 2e-95 AT5G38290 348 / 3e-122 Peptidyl-tRNA hydrolase family protein (.1.2)
Potri.001G005000 177 / 6e-57 AT5G19830 327 / 4e-115 Peptidyl-tRNA hydrolase family protein (.1)
Potri.012G061100 161 / 3e-50 AT1G18440 343 / 2e-119 Peptidyl-tRNA hydrolase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Representative CDS sequence
>Lus10031327 pacid=23151042 polypeptide=Lus10031327 locus=Lus10031327.g ID=Lus10031327.BGIv1.0 annot-version=v1.0
ATGGTTGCAGGATGTGTTGGGGAGGTGCCGATCCTGTTGGCGAAGCCACAAGCTTACATGAATTTCAGTGGCGAATCGGTTGGACCTCTTGCTGCATACT
ATCAAGTGCCCCTTCGTCATATTCTATTGATATACGATGAGATGAGCTTGCCGAATGGTGTTATGAGACTTCAGCCAAAAGGTGGCCATGGCCATCATAA
CGGTGTCAAGAGCGTGATCGACCATTTAGATGGATGCCGACAGTTCCCTCGATTATGCATCGGCATCGGGAACCCACCGGGGACGATGGACATGAAGGCT
TTCCTACTACAGAGATTCAGCCCTGCCGAGCGAACTCAGATCGATATAGCGACGGAGCAAGGGGTTGAAGCTGTGACCAACTTGGTGCTCAATGGATTCA
CCCAAAAGATTACCAGATTCAATCTCAGCCAAAAATACAAGTATCACAAAGTGTAG
AA sequence
>Lus10031327 pacid=23151042 polypeptide=Lus10031327 locus=Lus10031327.g ID=Lus10031327.BGIv1.0 annot-version=v1.0
MVAGCVGEVPILLAKPQAYMNFSGESVGPLAAYYQVPLRHILLIYDEMSLPNGVMRLQPKGGHGHHNGVKSVIDHLDGCRQFPRLCIGIGNPPGTMDMKA
FLLQRFSPAERTQIDIATEQGVEAVTNLVLNGFTQKITRFNLSQKYKYHKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38290 Peptidyl-tRNA hydrolase family... Lus10031327 0 1
AT2G42190 unknown protein Lus10031232 4.2 0.8904
AT5G16140 Peptidyl-tRNA hydrolase family... Lus10031901 8.0 0.9020
AT2G34960 CAT5 cationic amino acid transporte... Lus10018691 8.4 0.8388
AT2G39470 PnsL1, PPL2 Photosynthetic NDH subcomplex... Lus10023436 9.6 0.9035
AT3G24590 PLSP1 plastidic type i signal peptid... Lus10034925 10.1 0.8234
AT3G29185 Domain of unknown function (DU... Lus10032999 10.6 0.8960
AT1G70760 NdhL, CRR23 NADH dehydrogenase-like comple... Lus10030538 12.6 0.9023
AT5G13410 FKBP-like peptidyl-prolyl cis-... Lus10040937 14.1 0.9007
AT1G79040 PSBR photosystem II subunit R (.1) Lus10042461 14.9 0.9022
AT4G04900 RIC10 ROP-interactive CRIB motif-con... Lus10007648 17.6 0.8412

Lus10031327 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.