Lus10031339 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36950 102 / 1e-26 MAPKKK21 mitogen-activated protein kinase kinase kinase 21 (.1)
AT3G50310 97 / 1e-24 MKKK20, MAPKKK20 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
AT3G45790 95 / 1e-23 Protein kinase superfamily protein (.1)
AT3G46140 92 / 1e-22 Protein kinase superfamily protein (.1)
AT5G27510 91 / 1e-22 Protein kinase superfamily protein (.1)
AT5G55090 92 / 2e-22 MAPKKK15 mitogen-activated protein kinase kinase kinase 15 (.1)
AT4G26890 92 / 3e-22 MAPKKK16 mitogen-activated protein kinase kinase kinase 16 (.1)
AT5G67080 89 / 2e-21 MAPKKK19 mitogen-activated protein kinase kinase kinase 19 (.1)
AT3G45670 87 / 5e-21 Protein kinase superfamily protein (.1)
AT2G32510 87 / 6e-21 MAPKKK17 mitogen-activated protein kinase kinase kinase 17 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034288 142 / 4e-42 AT3G50310 181 / 5e-55 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034285 140 / 1e-41 AT5G27510 183 / 6e-56 Protein kinase superfamily protein (.1)
Lus10034242 138 / 7e-41 AT3G50310 190 / 2e-58 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10039141 125 / 9e-36 AT3G46140 168 / 1e-49 Protein kinase superfamily protein (.1)
Lus10026894 116 / 2e-32 AT3G50310 187 / 1e-57 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10034216 101 / 7e-28 AT5G27510 107 / 2e-28 Protein kinase superfamily protein (.1)
Lus10029018 94 / 5e-25 AT3G46140 52 / 7e-17 Protein kinase superfamily protein (.1)
Lus10017114 90 / 3e-22 AT3G50310 127 / 3e-34 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Lus10012668 89 / 1e-21 AT3G50310 347 / 5e-119 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131100 117 / 7e-33 AT3G50310 200 / 4e-62 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.003G184200 111 / 8e-30 AT4G36950 246 / 8e-79 mitogen-activated protein kinase kinase kinase 21 (.1)
Potri.001G042400 109 / 5e-29 AT3G50310 236 / 5e-75 MAPKK kinase 20, mitogen-activated protein kinase kinase kinase 20 (.1)
Potri.006G181000 107 / 2e-28 AT3G45670 213 / 4e-66 Protein kinase superfamily protein (.1)
Potri.007G044800 99 / 1e-25 AT5G67080 350 / 6e-120 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.005G139300 98 / 5e-25 AT5G67080 329 / 6e-112 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.005G139200 92 / 6e-23 AT5G67080 305 / 2e-102 mitogen-activated protein kinase kinase kinase 19 (.1)
Potri.004G007700 92 / 3e-22 AT5G55090 321 / 2e-105 mitogen-activated protein kinase kinase kinase 15 (.1)
Potri.011G007400 91 / 8e-22 AT5G55090 326 / 3e-107 mitogen-activated protein kinase kinase kinase 15 (.1)
Potri.001G278600 90 / 1e-21 AT1G07150 353 / 2e-117 mitogen-activated protein kinase kinase kinase 13 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10031339 pacid=23150991 polypeptide=Lus10031339 locus=Lus10031339.g ID=Lus10031339.BGIv1.0 annot-version=v1.0
ATGGCTCCCGGCTGGTATCGTGGGGAGAAATTAGGCAAAGGAGGATACGGAGAAGTATTCATAGCCGTCCCTGAAAAGCCAGGCCAGCTCATGGCCGTCA
AATCGGCTCCCGAACACGAAGCCGATACGCTAATCAAAGAGCGTGACTTCCTAGAGAAACTTGCCGGCGTACCTGGAATCGTCCGCTGCTACGGCGGAGA
GTTCACCGGAGAGAATCCGAGGACCTTCAACTTGCTCCTCGAGTACGCCCCCGTGGGGAATTTATGCGATTTGATCAGCTCCAGCGGATTGGGTATCCCG
GAACGGTTCGTCAGGGTTTTCACCCGGTCGTTGCTCAAGGCGCTGAAGACGATCCATTCACGCCGGTGGGTTCACTGTGATATCAAGCCGGACAACATCC
TCGTGTTCCCTCCGCAGCCGGGAGCCGCCAGCCGGTGGGATTAA
AA sequence
>Lus10031339 pacid=23150991 polypeptide=Lus10031339 locus=Lus10031339.g ID=Lus10031339.BGIv1.0 annot-version=v1.0
MAPGWYRGEKLGKGGYGEVFIAVPEKPGQLMAVKSAPEHEADTLIKERDFLEKLAGVPGIVRCYGGEFTGENPRTFNLLLEYAPVGNLCDLISSSGLGIP
ERFVRVFTRSLLKALKTIHSRRWVHCDIKPDNILVFPPQPGAASRWD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36950 MAPKKK21 mitogen-activated protein kina... Lus10031339 0 1
AT4G04980 unknown protein Lus10031636 1.4 0.7920
AT3G45400 exostosin family protein (.1) Lus10020308 12.7 0.6967
AT1G79960 OFP ATOFP14, OFP14 ovate family protein 14 (.1) Lus10035891 15.7 0.7191
AT1G07430 HAI2 highly ABA-induced PP2C gene 2... Lus10040738 28.0 0.6532
AT2G34160 Alba DNA/RNA-binding protein (... Lus10021222 28.8 0.6679
AT1G20925 Auxin efflux carrier family pr... Lus10004287 56.9 0.6200
AT3G04890 Uncharacterized conserved prot... Lus10009193 59.2 0.5997
Lus10027520 64.4 0.6162
AT5G20190 Tetratricopeptide repeat (TPR)... Lus10043266 66.9 0.6231
AT3G14440 SIS7, ATNCED3, ... SALT TOLERANT 1, SUGAR INSENSI... Lus10026185 74.5 0.5634

Lus10031339 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.