Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013632 [exp] 48 / 4e-08 AT5G17840 111 / 9e-31 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1) Lus10001325 [exp] 44 / 2e-07 ND 34 / 0.001 Lus10019094 [exp] 38 / 0.0001 AT3G47510 50 / 1e-08 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G066600 [exp] 57 / 1e-12 AT3G47510 40 / 2e-05 unknown protein Potri.008G087700 [exp] 37 / 7e-05 ND / Potri.015G062300 [exp] 37 / 9e-05 AT3G47510 53 / 1e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031340 pacid=23150989 polypeptide=Lus10031340 locus=Lus10031340.g ID=Lus10031340.BGIv1.0 annot-version=v1.0 ATGACGATTTTGAATCCTCGAATTCCGATCCCTGGTTCGTTTGTTCCACGATCCGACCTCCTCGCTCAGGATGAATTAGTGATGGACAATGATGAACTCG GATTTGATCATGTTGGAGGAAGGATGGAGCTCGAAAGAATGGATTATCCAGGAACTGGAGCCAACAACCACCATGATCCTAAACCCCCTGGAGGCAGACC TTAA
AA sequence Show only first row Show all	>Lus10031340 pacid=23150989 polypeptide=Lus10031340 locus=Lus10031340.g ID=Lus10031340.BGIv1.0 annot-version=v1.0 MTILNPRIPIPGSFVPRSDLLAQDELVMDNDELGFDHVGGRMELERMDYPGTGANNHHDPKPPGGRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10031340 [exp]	0	1
AT4G39490		CYP96A10	"cytochrome P450, family 96, s...		Lus10025678 [exp]	2.0	0.9292
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10042940 [exp]	2.8	0.8917
AT1G43650			nodulin MtN21 /EamA-like trans...		Lus10018889 [exp]	5.7	0.9109
AT4G02290		ATGH9B13	glycosyl hydrolase 9B13 (.1)		Lus10038223 [exp]	6.5	0.8786
AT1G02640		ATBXL2, BXL2	beta-xylosidase 2 (.1)		Lus10010015 [exp]	9.6	0.9258
AT1G72300			Leucine-rich receptor-like pro...		Lus10019722 [exp]	13.0	0.8807
AT4G26590		ATOPT5	ARABIDOPSIS THALIANA OLIGOPEPT...		Lus10016633 [exp]	14.0	0.9035
AT1G32770	NAC	NST3, ANAC012, ...	SECONDARY WALL-ASSOCIATED NAC ...		Lus10033239 [exp]	19.9	0.8948
AT4G35240			Protein of unknown function (D...		Lus10012276 [exp]	27.0	0.8924
AT2G46770	NAC	NST1, ANAC043, ...	NAC SECONDARY WALL THICKENING...		Lus10002687 [exp]	27.5	0.8914

Compare expression of checked genes

Lus10031340 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.