Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18170 224 / 2e-74 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G73655 180 / 3e-57 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G10060 59 / 1e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G26555 57 / 6e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G19830 57 / 7e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G25340 50 / 3e-07 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT4G39710 49 / 4e-07 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT5G45680 49 / 4e-07 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT1G20810 48 / 6e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 46 / 2e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027246 [exp] 163 / 1e-50 AT1G18170 187 / 2e-59 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038954 [exp] 157 / 3e-48 AT1G18170 193 / 1e-61 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10009062 [exp] 110 / 3e-28 AT1G73660 673 / 0.0 protein tyrosine kinase family protein (.1) Lus10035560 [exp] 59 / 1e-10 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031700 [exp] 59 / 3e-10 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2) Lus10027729 [exp] 57 / 6e-10 AT3G10060 285 / 1e-97 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10036206 [exp] 56 / 8e-10 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031121 [exp] 54 / 1e-08 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10038345 [exp] 54 / 1e-08 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G048300 [exp] 226 / 8e-75 AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.016G096600 [exp] 58 / 2e-10 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G119800 [exp] 56 / 2e-09 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 54 / 1e-08 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.005G079700 [exp] 50 / 1e-07 AT4G39710 243 / 1e-81 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.001G075500 [exp] 50 / 2e-07 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.014G149400 [exp] 49 / 8e-07 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G467100 [exp] 47 / 9e-07 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.012G129200 [exp] 48 / 1e-06 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.001G068300 [exp] 43 / 4e-05 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10031342 pacid=23151061 polypeptide=Lus10031342 locus=Lus10031342.g ID=Lus10031342.BGIv1.0 annot-version=v1.0 ATGGCTGCTAGCGTTAGGGACAGCAAAAGGACAAAAGCTGAGAGTACTGACTGGATAGCATCAAGCTTGACCAGAAGGTTTGGGCTCGGGGCCGGATTGG GCTGGGCCGGGTTTCTGGCTGTCGGGGTGATATCCGAGCAGGTCAAGACCCGACTCGAGATCAACGAAGAGGTTTCCAATACCAGGGATGTGGAGAAGGA AGAAGAAGTCATTTTGCCAAATGGAATAAAGTACTACGAGCTGAAGGTGGGGGGAGGGGCGAAGCCGATAACAGGCGACCTGGTGGTGATCAACCTGAAA GGGAGGGTACTCAAGGACGAAGTGTACTTCGTGGACACGTTGGAGACGAAGAAGCCGCTCGCTCTGGTGATGGGTTCGAGGCTGTACACGAGAGGGATGT GTGAAGGGGTGGAGTATGTGTTGAGGGGAATGAAGGGTGGTGGGAAGAGGAGAGTGATTGTCCCTCCTAGTTTAGGGTTTGGGGAAGAAGGTGCTATTTT GGGATCAATAAGGATTCCACCTTCCTCTACTCTTGAGTACATTGTTCAACTTGATAGAGTCTCCATTGCACCTGCCTAA
AA sequence Show only first row Show all	>Lus10031342 pacid=23151061 polypeptide=Lus10031342 locus=Lus10031342.g ID=Lus10031342.BGIv1.0 annot-version=v1.0 MAASVRDSKRTKAESTDWIASSLTRRFGLGAGLGWAGFLAVGVISEQVKTRLEINEEVSNTRDVEKEEEVILPNGIKYYELKVGGGAKPITGDLVVINLK GRVLKDEVYFVDTLETKKPLALVMGSRLYTRGMCEGVEYVLRGMKGGGKRRVIVPPSLGFGEEGAILGSIRIPPSSTLEYIVQLDRVSIAPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G18170			FKBP-like peptidyl-prolyl cis-...		Lus10031342 [exp]	0	1
AT4G09010		TL29, APX4	thylakoid lumen 29, ascorbate ...		Lus10008718 [exp]	2.2	0.9405
AT1G60550		ECHID, DHNS	enoyl-CoA hydratase/isomerase ...		Lus10029142 [exp]	3.5	0.9225
AT1G64150			Uncharacterized protein family...		Lus10024713 [exp]	5.5	0.9274
AT3G45050			unknown protein		Lus10041331 [exp]	6.8	0.9338
AT1G58290		AtHEMA1, HEMA1	Arabidopsis thaliana hemA 1, G...		Lus10028226 [exp]	9.2	0.9014
AT1G64150			Uncharacterized protein family...		Lus10032330 [exp]	12.4	0.9136
AT4G15510			Photosystem II reaction center...		Lus10000614 [exp]	12.4	0.9215
AT1G60550		ECHID, DHNS	enoyl-CoA hydratase/isomerase ...		Lus10013023 [exp]	12.7	0.9008
AT4G25080		CHLM	magnesium-protoporphyrin IX me...		Lus10016728 [exp]	14.3	0.9183
AT4G25080		CHLM	magnesium-protoporphyrin IX me...		Lus10016730 [exp]	14.4	0.9162

Compare expression of checked genes

Lus10031342 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.