Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18250 190 / 2e-62 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G73620 190 / 3e-62 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75030 140 / 5e-43 ATLP-3 thaumatin-like protein 3 (.1) AT1G75050 138 / 7e-42 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75040 135 / 4e-41 PR-5, PR5 pathogenesis-related gene 5 (.1) AT1G77700 134 / 2e-39 Pathogenesis-related thaumatin superfamily protein (.1) AT1G20030 131 / 9e-39 Pathogenesis-related thaumatin superfamily protein (.1.2) AT4G36000 126 / 6e-38 Pathogenesis-related thaumatin superfamily protein (.1) AT1G19320 126 / 3e-37 Pathogenesis-related thaumatin superfamily protein (.1) AT4G38660 127 / 6e-37 Pathogenesis-related thaumatin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009058 [exp] 220 / 4e-74 AT1G73620 376 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1) Lus10028448 [exp] 131 / 7e-39 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10041901 [exp] 131 / 1e-38 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10032726 [exp] 124 / 1e-36 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1) Lus10013561 [exp] 125 / 5e-36 AT4G38660 326 / 2e-112 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10028079 [exp] 120 / 1e-35 AT1G77700 176 / 1e-54 Pathogenesis-related thaumatin superfamily protein (.1) Lus10017266 [exp] 123 / 2e-35 AT4G24180 322 / 7e-111 THAUMATIN-LIKE PROTEIN 1 (.1) Lus10017265 [exp] 119 / 7e-34 AT1G75800 390 / 2e-136 Pathogenesis-related thaumatin superfamily protein (.1) Lus10028447 [exp] 119 / 8e-34 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G039200 [exp] 187 / 4e-61 AT1G73620 352 / 1e-123 Pathogenesis-related thaumatin superfamily protein (.1) Potri.012G047800 [exp] 186 / 6e-61 AT1G73620 379 / 3e-134 Pathogenesis-related thaumatin superfamily protein (.1) Potri.005G173900 [exp] 135 / 2e-40 AT1G77700 316 / 2e-107 Pathogenesis-related thaumatin superfamily protein (.1) Potri.002G087100 [exp] 135 / 3e-40 AT1G77700 384 / 2e-134 Pathogenesis-related thaumatin superfamily protein (.1) Potri.005G241000 [exp] 135 / 7e-40 AT4G24180 348 / 5e-121 THAUMATIN-LIKE PROTEIN 1 (.1) Potri.004G173200 [exp] 134 / 2e-39 AT4G38660 357 / 5e-123 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.014G040700 [exp] 130 / 4e-39 AT1G75030 342 / 5e-120 thaumatin-like protein 3 (.1) Potri.009G132500 [exp] 132 / 6e-39 AT4G38660 338 / 3e-115 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.002G020400 [exp] 132 / 8e-39 AT4G38660 357 / 2e-123 Pathogenesis-related thaumatin superfamily protein (.1.2) Potri.005G112700 [exp] 129 / 6e-38 AT4G36010 372 / 3e-130 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0293 [flax] [poplar] CDC PF00314 [flax] [poplar] Thaumatin Thaumatin family
Representative CDS sequence Show only first row Show all	>Lus10031346 pacid=23151158 polypeptide=Lus10031346 locus=Lus10031346.g ID=Lus10031346.BGIv1.0 annot-version=v1.0 ATGGCGGTTAAGCCGGTGAAGGGTACCGGAATGTGTAGCTACGCCGGTTGCGTCAGCGATCTGAACTTGATGTGCCCCGCCGGACTTCAGGTGAGGTCAC GCGACAACAAGAACGTGGTCGCGTGCAGGAGCGCATGCTCGGCATTCAACTCGCCGAGGTACTGCTGTACGGGGGCGTTCGGGAACCCACAGACGTGCAA ACCTACGGCCTATTCGAGGATCTTCAAGGCGGCTTGCCCTAGGGCTTACTCGTACGCTTACGATGATCCGACGAGCATTGCTACTTGCACCGGAGGGAAC TACATCGTCACATTCTGCCCTCCCCGCCGCCGGTGA
AA sequence Show only first row Show all	>Lus10031346 pacid=23151158 polypeptide=Lus10031346 locus=Lus10031346.g ID=Lus10031346.BGIv1.0 annot-version=v1.0 MAVKPVKGTGMCSYAGCVSDLNLMCPAGLQVRSRDNKNVVACRSACSAFNSPRYCCTGAFGNPQTCKPTAYSRIFKAACPRAYSYAYDDPTSIATCTGGN YIVTFCPPRRR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73620			Pathogenesis-related thaumatin...		Lus10031346 [exp]	0	1
AT1G76420	NAC	NAC368, CUC3, A...	CUP SHAPED COTYLEDON3, Arabido...		Lus10013205 [exp]	1.7	0.9943
AT1G54215			proline-rich family protein (....		Lus10037669 [exp]	3.5	0.9940
AT3G18960	B3		AP2/B3-like transcriptional fa...		Lus10012046 [exp]	5.9	0.9891
					Lus10021217 [exp]	6.0	0.9914
AT5G01150			Protein of unknown function (D...		Lus10003168 [exp]	7.3	0.9908
AT1G12980	AP2_ERF	DRN, ESR1	ENHANCER OF SHOOT REGENERATION...		Lus10014345 [exp]	11.5	0.9942
AT5G45980	HD	WOX9B, STPL, WO...	WUSCHEL related homeobox 9B, S...		Lus10013960 [exp]	13.7	0.9874
AT5G02030	HD	PNY, BLR, BLH9,...	VAAMANA, REPLUMLESS, PENNYWISE...		Lus10004688 [exp]	18.8	0.9912
					Lus10009719 [exp]	24.2	0.9890
AT2G42560			late embryogenesis abundant do...		Lus10002197 [exp]	24.3	0.9866

Compare expression of checked genes

Lus10031346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.