Lus10031353 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G25820 56 / 4e-09 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2)
AT3G25830 56 / 4e-09 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1)
AT2G24210 54 / 2e-08 AtTPS10 terpene synthase 10 (.1)
AT3G25810 51 / 1e-07 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
AT4G16740 49 / 5e-07 ATTPS03 terpene synthase 03 (.1.2)
AT4G16730 40 / 0.0005 AtTPS02 terpene synthase 02 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033643 94 / 3e-22 AT4G16730 356 / 2e-115 terpene synthase 02 (.1)
Lus10025922 93 / 9e-22 AT3G25810 353 / 3e-114 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Lus10038179 87 / 1e-19 AT3G25810 351 / 2e-113 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Lus10006356 70 / 6e-14 AT3G25820 371 / 3e-121 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2)
Lus10001110 65 / 3e-12 AT3G25810 362 / 1e-118 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Lus10012312 56 / 4e-09 AT4G16740 363 / 3e-118 terpene synthase 03 (.1.2)
Lus10006355 51 / 2e-07 AT2G24210 361 / 7e-117 terpene synthase 10 (.1)
Lus10008614 51 / 2e-07 AT5G23960 345 / 1e-112 terpene synthase 21 (.1.2)
Lus10042202 49 / 1e-06 AT5G23960 302 / 8e-96 terpene synthase 21 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G016116 56 / 3e-09 AT5G23960 236 / 8e-75 terpene synthase 21 (.1.2)
Potri.015G032100 54 / 2e-08 AT5G23960 444 / 8e-151 terpene synthase 21 (.1.2)
Potri.015G085500 53 / 2e-08 AT5G23960 456 / 1e-155 terpene synthase 21 (.1.2)
Potri.007G118600 52 / 7e-08 AT4G16740 462 / 3e-157 terpene synthase 03 (.1.2)
Potri.019G023018 51 / 8e-08 AT4G16740 115 / 2e-30 terpene synthase 03 (.1.2)
Potri.017G041700 52 / 9e-08 AT3G25810 432 / 3e-145 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Potri.007G119700 51 / 2e-07 AT4G16740 438 / 8e-147 terpene synthase 03 (.1.2)
Potri.019G023006 50 / 2e-07 AT3G25830 540 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1)
Potri.019G045100 50 / 2e-07 AT5G23960 474 / 2e-162 terpene synthase 21 (.1.2)
Potri.019G016400 50 / 2e-07 AT5G23960 436 / 5e-148 terpene synthase 21 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01397 Terpene_synth Terpene synthase, N-terminal domain
Representative CDS sequence
>Lus10031353 pacid=23155813 polypeptide=Lus10031353 locus=Lus10031353.g ID=Lus10031353.BGIv1.0 annot-version=v1.0
ATGGCGGTTGTCGGTGCTGGTCGTGTTCTTAACTCCGGCCTAATTGCCGGCGGCGGCGGATTCATGAATAACCCAGCAAACAGACAGTTTATCACTATGG
ATAATCTTCGTTTCATGAAATATCGTAATTGTTCATCAACTTCTGTAATGTGTAACATGCAGCAGGACGAAGCTACTGGTAAAAACATTCATCGTAGATC
TGGCAACTACCAGCCGGGGATGTGGGGCATCGACGATTCTCCTCATCGTCACTTACTTCACTACGCTGGCGGCGCCAGCACTACTTTCCCGTCCACCAAT
AGTACTGATTCATCATCAAGAACAATGGTGAAAATGGAAGAGTTGAAGAAATATGTGAAGGGTTTGATAGAGGAGAAGGCTATGGGAAGTGATGAACAAG
TAACACACAAGCTGGAGTTGATTGATGAAGTTCAACGGCTAGGGTTGGGTTACCATTTTCATAGTGAGATTCATACTGCTCTCCAACAAATTGCTTCTTC
TTCTGATCAGTCGCCGGAGCTGGAGAGCCTCCGTGCTCACGCCCTCCGGTTCAGGCTTTTCCGGCAGGCCGGCATCCCCATTTCCCAAGGTGGTGGAAAG
ACTTGGGTCTGA
AA sequence
>Lus10031353 pacid=23155813 polypeptide=Lus10031353 locus=Lus10031353.g ID=Lus10031353.BGIv1.0 annot-version=v1.0
MAVVGAGRVLNSGLIAGGGGFMNNPANRQFITMDNLRFMKYRNCSSTSVMCNMQQDEATGKNIHRRSGNYQPGMWGIDDSPHRHLLHYAGGASTTFPSTN
STDSSSRTMVKMEELKKYVKGLIEEKAMGSDEQVTHKLELIDEVQRLGLGYHFHSEIHTALQQIASSSDQSPELESLRAHALRFRLFRQAGIPISQGGGK
TWV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G25820 ATTPS-CIN "terpene synthase-like sequenc... Lus10031353 0 1

Lus10031353 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.