Lus10031385 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G58750 87 / 7e-21 CSY2 citrate synthase 2 (.1)
AT2G42790 87 / 1e-20 CSY3 citrate synthase 3 (.1)
AT3G58740 68 / 3e-14 CSY1 citrate synthase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031384 98 / 1e-24 AT3G58750 796 / 0.0 citrate synthase 2 (.1)
Lus10010945 95 / 1e-23 AT2G42790 855 / 0.0 citrate synthase 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G089300 95 / 1e-23 AT3G58750 855 / 0.0 citrate synthase 2 (.1)
Potri.014G141900 95 / 2e-23 AT3G58750 867 / 0.0 citrate synthase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00285 Citrate_synt Citrate synthase, C-terminal domain
Representative CDS sequence
>Lus10031385 pacid=23155950 polypeptide=Lus10031385 locus=Lus10031385.g ID=Lus10031385.BGIv1.0 annot-version=v1.0
ATGTCCAGATTAGAAGACAGCTCCCGATCTTCCTCCTCCGCCACCGCCCGCCTGGGGGTGCTCGCATCTCATTTGGCTGCAGCTGCTTCCAGGGAGTCGC
CCTTCGCCGGCATCGAGCGGTTGGTTGTTTTGAGTAATGACAATGGTCGCACTCCCAACCTTACGGGTACGCTTACCGTTGTCAACGACAAGCCGGCCAG
ACTCACAAACTCCTGGTGTCTGAGCATGGCACCGTCAGTGCCTCCGATTTCAAGAAGGAAAGAGCGGGCAATGGGATTCCCTACAGAGTTCTTCCCTGTT
CTGCTTGTAATTCCTCGAATGGCCGGTTACTTAGCTCACTGGCGAGAGTCGCTCGATGATCCGGACACAAAGATCATGAGACCTCAGCAGGCCAGTTCTT
AA
AA sequence
>Lus10031385 pacid=23155950 polypeptide=Lus10031385 locus=Lus10031385.g ID=Lus10031385.BGIv1.0 annot-version=v1.0
MSRLEDSSRSSSSATARLGVLASHLAAAASRESPFAGIERLVVLSNDNGRTPNLTGTLTVVNDKPARLTNSWCLSMAPSVPPISRRKERAMGFPTEFFPV
LLVIPRMAGYLAHWRESLDDPDTKIMRPQQASS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G58750 CSY2 citrate synthase 2 (.1) Lus10031385 0 1
Lus10031026 13.3 0.8707
Lus10014856 15.0 0.8108
AT2G37740 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) Lus10004705 24.0 0.8625
AT2G24560 GDSL-like Lipase/Acylhydrolase... Lus10026405 32.2 0.8539
AT4G27300 S-locus lectin protein kinase ... Lus10038555 68.1 0.8161
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10025073 80.1 0.7958
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10012039 115.9 0.7982
Lus10003493 131.6 0.8067
AT2G45410 AS2 LBD19 LOB domain-containing protein ... Lus10009298 142.7 0.7946
Lus10009436 145.6 0.7981

Lus10031385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.