Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42820 246 / 4e-85 HVA22F HVA22-like protein F (.1) AT1G74520 113 / 4e-32 ATHVA22A HVA22 homologue A (.1) AT5G50720 109 / 2e-31 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT5G62490 109 / 7e-31 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT1G69700 109 / 9e-31 ATHVA22C HVA22 homologue C (.1) AT4G24960 103 / 8e-29 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT4G36720 64 / 6e-13 HVA22K HVA22-like protein K (.1) AT1G75700 56 / 3e-10 HVA22G HVA22-like protein G (.1) AT1G19950 56 / 2e-09 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT5G42560 53 / 1e-08 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010944 [exp] 327 / 1e-116 AT2G42820 246 / 7e-85 HVA22-like protein F (.1) Lus10037191 [exp] 125 / 8e-37 AT1G69700 231 / 6e-78 HVA22 homologue C (.1) Lus10024234 [exp] 124 / 6e-36 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10023605 [exp] 123 / 8e-36 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10032557 [exp] 110 / 9e-32 AT5G50720 172 / 8e-57 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10043186 [exp] 110 / 1e-31 AT5G50720 169 / 1e-55 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10042193 [exp] 118 / 2e-31 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10008623 [exp] 105 / 3e-29 AT1G74520 234 / 5e-80 HVA22 homologue A (.1) Lus10034519 [exp] 53 / 1e-08 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G006000 [exp] 223 / 1e-75 AT2G42820 235 / 1e-80 HVA22-like protein F (.1) Potri.012G069300 [exp] 118 / 3e-34 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.015G062800 [exp] 116 / 1e-33 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.014G148600 [exp] 115 / 2e-33 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) Potri.012G101600 [exp] 108 / 1e-30 AT5G50720 133 / 3e-41 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.015G099700 [exp] 107 / 2e-30 AT5G50720 166 / 5e-54 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.005G152100 [exp] 80 / 7e-18 AT1G69700 102 / 1e-25 HVA22 homologue C (.1) Potri.017G139000 [exp] 77 / 4e-17 AT1G74520 119 / 5e-32 HVA22 homologue A (.1) Potri.009G078500 [exp] 72 / 4e-15 AT1G74520 104 / 6e-26 HVA22 homologue A (.1) Potri.001G283000 [exp] 72 / 4e-15 AT1G74520 98 / 1e-23 HVA22 homologue A (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [flax] [poplar] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Lus10031386 pacid=23155876 polypeptide=Lus10031386 locus=Lus10031386.g ID=Lus10031386.BGIv1.0 annot-version=v1.0 ATGGGAGTTCCGTCAGCAATAGCCAAGGGGTTGAACGCATTCATCGGGCCGGGGTTGATCCTTCTGTACCCGTTGTATGCTTCGTTGAGAGCGATAGAGA GCCCTTCAATGGTGGACGATCAGCAATGGCTGACTTACTGGATCATTTACTCCTTCATTACCTTGTTTGAGCTCTCCTTTTGGAAAGTCCTTGCTTGGTT CCCATTCTGGGCGTACATAAAGCTGGTGTTCTGCATGTGGCTGGTCCTCCCGATGTTCAACGGCGCCGCCTACATCCACGAGACCATGTTGAGGAAGTAC GTCAAGATCGGAATCACAACCATCACCGGCGACAACACTTCGAACTACACCGATGAACAGAGGAAGGTGCTTCAGATGATGAGCTTGGACGCTAGGAAGT CTGTGGTCGAGTACGTTAACAAGTACGGCTGGGATGCCGTCGACAGAGCCATCAAAGCTGCTGAAAAGGAGACGAAGAAACATTAA
AA sequence Show only first row Show all	>Lus10031386 pacid=23155876 polypeptide=Lus10031386 locus=Lus10031386.g ID=Lus10031386.BGIv1.0 annot-version=v1.0 MGVPSAIAKGLNAFIGPGLILLYPLYASLRAIESPSMVDDQQWLTYWIIYSFITLFELSFWKVLAWFPFWAYIKLVFCMWLVLPMFNGAAYIHETMLRKY VKIGITTITGDNTSNYTDEQRKVLQMMSLDARKSVVEYVNKYGWDAVDRAIKAAEKETKKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G42820		HVA22F	HVA22-like protein F (.1)		Lus10031386 [exp]	0	1
AT3G18260			Reticulon family protein (.1)		Lus10032451 [exp]	1.0	0.9916
AT2G42820		HVA22F	HVA22-like protein F (.1)		Lus10010944 [exp]	1.4	0.9814
AT1G13920			Remorin family protein (.1)		Lus10037111 [exp]	2.4	0.9783
AT5G08391			Protein of unknown function (D...		Lus10035201 [exp]	4.8	0.9176
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10009316 [exp]	4.9	0.9731
AT2G20362			unknown protein		Lus10022860 [exp]	5.3	0.9320
AT1G54400			HSP20-like chaperones superfam...		Lus10032902 [exp]	5.9	0.9649
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10017204 [exp]	7.9	0.9202
AT1G13920			Remorin family protein (.1)		Lus10026649 [exp]	9.2	0.9555
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	10.4	0.9575

Compare expression of checked genes

Lus10031386 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.