Lus10031387 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25140 145 / 5e-45 OLE1, OLEO1 oleosin 1 (.1)
AT2G25890 115 / 1e-33 Oleosin family protein (.1)
AT5G51210 112 / 2e-32 OLEO3 oleosin3 (.1)
AT3G01570 75 / 2e-17 Oleosin family protein (.1)
AT5G40420 75 / 3e-17 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G27660 70 / 2e-15 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G07550 67 / 3e-15 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3)
AT3G18570 63 / 4e-13 Oleosin family protein (.1)
AT5G61610 62 / 4e-12 Oleosin family protein (.1)
AT1G48990 57 / 6e-11 Oleosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010943 223 / 2e-70 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10027161 184 / 1e-60 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10039683 175 / 4e-57 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10017460 157 / 9e-50 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10028822 152 / 3e-48 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10022141 90 / 5e-22 AT4G25140 106 / 3e-28 oleosin 1 (.1)
Lus10017992 79 / 8e-19 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Lus10041987 76 / 1e-17 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Lus10042957 69 / 3e-15 AT3G18570 139 / 2e-42 Oleosin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G080000 135 / 7e-42 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.003G150600 135 / 7e-42 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.006G234900 106 / 5e-30 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.018G057800 93 / 6e-25 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.001G345800 78 / 8e-19 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.T125308 75 / 1e-17 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.015G081901 75 / 1e-17 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.017G071800 72 / 9e-17 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
Potri.012G083400 71 / 4e-16 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.012G059400 68 / 6e-15 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10031387 pacid=23156033 polypeptide=Lus10031387 locus=Lus10031387.g ID=Lus10031387.BGIv1.0 annot-version=v1.0
ATGGATCAGTCACATCAGACGCAGTACGGCGGCACCATGCAAAACCAACCGCAGTACCAAACAAAGTCTTACCAGGCAGTGAAGGCCGCCACCGCCGCCA
CTGCCGGTGGGTCTCTCCTGGTTCTCTCCGGTCTCATCCTTGTCGCCACTGTCATTGCCTTGACCATGGCGACTCCTCTACTTGTCATCTTCAGCCCGGT
TCTCGTCCCGGCTCTGATCACCGTCGGGTTAGTGATCACCGGGTTTTTGGCCTCCGGTGGGTTCGGAGTGGCCGCCATCACCGTCTTGTCATGGATCTAT
AGGTATGTGACCGGGAGGCATCCTGTCGGAGCGGATTCGCTGGACCAGGCGAGGATGAGGATTTCCGGGAAGGCAAGGGAGATGAAGGATAGGGCGTCGG
ATTTCGGGCAGCAGCATGTTTCCGGTCAACAGACCTCTTAA
AA sequence
>Lus10031387 pacid=23156033 polypeptide=Lus10031387 locus=Lus10031387.g ID=Lus10031387.BGIv1.0 annot-version=v1.0
MDQSHQTQYGGTMQNQPQYQTKSYQAVKAATAATAGGSLLVLSGLILVATVIALTMATPLLVIFSPVLVPALITVGLVITGFLASGGFGVAAITVLSWIY
RYVTGRHPVGADSLDQARMRISGKAREMKDRASDFGQQHVSGQQTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25140 OLE1, OLEO1 oleosin 1 (.1) Lus10031387 0 1
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10002496 10.7 0.8063
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Lus10028514 10.8 0.8062
AT2G36020 HVA22J HVA22-like protein J (.1) Lus10004215 13.3 0.7707
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Lus10033427 16.3 0.8051
Lus10007128 18.0 0.7913
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10035525 19.1 0.8037
Lus10003755 23.0 0.8010
AT1G33530 F-box family protein (.1) Lus10014984 25.6 0.7925
AT2G38150 alpha 1,4-glycosyltransferase ... Lus10027771 25.9 0.7962
Lus10040989 26.7 0.6966

Lus10031387 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.