Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42850 118 / 3e-32 CYP718 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) AT5G36130 80 / 4e-20 Cytochrome P450 superfamily protein (.1) AT5G36110 78 / 1e-17 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT2G29090 69 / 2e-14 CYP707A2 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) AT5G45340 64 / 5e-13 CYP707A3 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) AT5G48000 61 / 9e-12 THAH1, THAH, CYP708A2 THALIANOL HYDROXYLASE 1, THALIANOL HYDROXYLASE, "cytochrome P450, family 708, subfamily A, polypeptide 2", cytochrome P450, family 708, subfamily A, polypeptide 2 (.1.2.3.4.5) AT3G19270 58 / 9e-11 CYP707A4 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) AT4G19230 56 / 4e-10 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT1G55940 51 / 3e-08 CYP708A1 "cytochrome P450, family 708, subfamily A, polypeptide 1", cytochrome P450, family 708, subfamily A, polypeptide 1 (.1) AT3G50660 47 / 6e-07 PSC1, CYP90B1, CLM, SNP2, DWF4, SAV1 SUPPRESSOR OF NPH4 2, SHADE AVOIDANCE 1, PARTIALLY SUPPRESSING COI1 INSENSITIVITY TO JA 1, DWARF 4, CYTOCHROME P450 90B1, CLOMAZONE-RESISTANT, Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010940 [exp] 158 / 5e-47 AT2G42850 571 / 0.0 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Lus10042652 [exp] 66 / 3e-13 AT3G19270 647 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10021725 [exp] 65 / 5e-13 AT3G19270 633 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10033308 [exp] 62 / 4e-12 AT5G45340 732 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10040055 [exp] 62 / 4e-12 AT5G36110 318 / 7e-104 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Lus10034768 [exp] 62 / 6e-12 AT5G45340 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10019858 [exp] 61 / 1e-11 AT3G19270 643 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10036670 [exp] 59 / 6e-11 AT1G05160 305 / 2e-98 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Lus10035685 [exp] 58 / 1e-10 AT4G19230 714 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G060700 [exp] 120 / 4e-33 AT2G42850 582 / 0.0 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Potri.006G085500 [exp] 82 / 3e-19 AT5G36110 573 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.012G115000 [exp] 76 / 4e-17 AT5G36110 295 / 7e-95 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.001G003000 [exp] 75 / 2e-16 AT5G36110 389 / 3e-131 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.013G106100 [exp] 74 / 2e-16 AT5G36110 470 / 4e-163 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G057901 [exp] 72 / 1e-15 AT5G36110 279 / 2e-88 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G080500 [exp] 71 / 3e-15 AT5G36110 456 / 7e-158 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.002G126100 [exp] 69 / 2e-14 AT3G19270 666 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.014G029100 [exp] 69 / 2e-14 AT3G19270 665 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.007G002400 [exp] 69 / 2e-14 AT5G36110 585 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10031391 pacid=23155838 polypeptide=Lus10031391 locus=Lus10031391.g ID=Lus10031391.BGIv1.0 annot-version=v1.0 ATGCAAATAGGGAAAAGGAAGGACCATCATGAATCAGAAATTCTCATAAATAATCCTGTAATTAATTTACTTTCCCAACCGTATGGGACGCATTACAACG AGGAGTACTTCAAGGATCCGATGAGCTTCAAGCCAGACCGGTTCGAACACCACACCATCCCACCCTATGTCTACGTGCCGTTCGGTGGAGGTCCCAGGGT CTGCGCCGGCCGCCAGCTAGCCAAGCTCAGCATCCTGGTACTAGTTCACCATGTTGTAACGGGTTATGACTGGTCGCTTGTTCTACCGAAGGAGAGAATC ACAATGGATCCTCTTCCTTTTCCTTCTCATGGAATGCCCATCCGGATAACTCCAAAAGCTTGTGGTGCAAGTAACCGCGTTTTAACTTAG
AA sequence Show only first row Show all	>Lus10031391 pacid=23155838 polypeptide=Lus10031391 locus=Lus10031391.g ID=Lus10031391.BGIv1.0 annot-version=v1.0 MQIGKRKDHHESEILINNPVINLLSQPYGTHYNEEYFKDPMSFKPDRFEHHTIPPYVYVPFGGGPRVCAGRQLAKLSILVLVHHVVTGYDWSLVLPKERI TMDPLPFPSHGMPIRITPKACGASNRVLT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10031391 [exp]	0	1
					Lus10000325 [exp]	2.2	1.0000
AT2G46760			D-arabinono-1,4-lactone oxidas...		Lus10004735 [exp]	3.9	1.0000
					Lus10002099 [exp]	4.2	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005495 [exp]	6.0	1.0000
					Lus10025316 [exp]	6.5	1.0000
					Lus10011594 [exp]	6.7	1.0000
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10030510 [exp]	7.0	1.0000
					Lus10032121 [exp]	7.1	1.0000
AT5G39200			unknown protein		Lus10030710 [exp]	7.5	1.0000
AT4G20800			FAD-binding Berberine family p...		Lus10006507 [exp]	7.7	1.0000

Compare expression of checked genes

Lus10031391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.