Lus10031392 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 383 / 5e-135 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 381 / 2e-134 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 375 / 4e-132 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 359 / 1e-125 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 358 / 5e-125 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 348 / 1e-121 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57540 337 / 1e-116 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57530 336 / 2e-116 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT2G18800 335 / 9e-116 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT4G25820 334 / 1e-115 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010938 583 / 0 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031393 573 / 0 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 567 / 0 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 530 / 0 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 525 / 0 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 514 / 0 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 439 / 6e-157 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 436 / 9e-156 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 436 / 1e-155 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G201250 443 / 1e-158 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 440 / 3e-157 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 439 / 5e-157 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 421 / 5e-150 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 402 / 1e-142 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 395 / 8e-140 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 384 / 4e-135 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095100 371 / 2e-130 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 368 / 5e-129 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 369 / 1e-128 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10031392 pacid=23155926 polypeptide=Lus10031392 locus=Lus10031392.g ID=Lus10031392.BGIv1.0 annot-version=v1.0
ATGGCGACTCTGCCTCTGATAATGTCGACATTGGTACTGTTGGGTCATTTAACGGCCATCACAAATGCAAACTTCCACCAGCATTTCGATATCACATGGG
GGCAGCACCATGCTCAGATCATGAACACCGGTCAGCAGTTGACCCTCTCGCTCGACAAGGATTCCGGAGCCGGATTCAAGTCCAAAAACGAGTATCTTTT
CGGCCGTATTGATATGCAACTCAAGCTCATCGCCGGCAACTCCGCTGGGAGTGTCACTACCTTTTATTTGTCGTCGGAAGGACCGAACCACGATGAAATC
GACTTCGAATTCCTTGGCAATTCGACCGGAAACCCTTACACTCTCCACACCAACGTGTTCAGCCAAGGGAAAGGCAACAGAGAACAGCAATTCCACCTTT
GGTTCGACCCAACTGCCGCTTTCCACACCTACACCATCCTCTGGAATTCCCAACGAATCATATTCTTGGTGGACAACATCCCCATCAGAGTGTTCAACAA
CTTAGAATCAATGGGAGTGCCATTCCTAAACAAGCAGCCAATGAGCATTCACTCTAGCTTATGGAACGCCGACGACTGGGCTACCCAAGGCGGCCGAGTG
AAGGCTGATTGGACCAAAGCTCCCTTCATAGCTTCTTACAGGAACTTCAAAGCAGAAGCTTGTGTTTGGTCGCCGTCCTCTGCTTCTTCAACGTGCACTC
CGGGAGCATGGCAGACACAGGGGATCGATGCCGCCGGCCGGAATAGGATCCGGTGGGTGCAGAGTAAATATATGATCTATAATTACTGCACTGACTTGAA
ACGATTCCCTCAAGGAGTTCCAGTTGAATGCAAGCAGACCAGATTCCTTTGA
AA sequence
>Lus10031392 pacid=23155926 polypeptide=Lus10031392 locus=Lus10031392.g ID=Lus10031392.BGIv1.0 annot-version=v1.0
MATLPLIMSTLVLLGHLTAITNANFHQHFDITWGQHHAQIMNTGQQLTLSLDKDSGAGFKSKNEYLFGRIDMQLKLIAGNSAGSVTTFYLSSEGPNHDEI
DFEFLGNSTGNPYTLHTNVFSQGKGNREQQFHLWFDPTAAFHTYTILWNSQRIIFLVDNIPIRVFNNLESMGVPFLNKQPMSIHSSLWNADDWATQGGRV
KADWTKAPFIASYRNFKAEACVWSPSSASSTCTPGAWQTQGIDAAGRNRIRWVQSKYMIYNYCTDLKRFPQGVPVECKQTRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10031392 0 1
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10031393 1.0 0.9291
Lus10011061 19.0 0.7782
Lus10022145 23.2 0.7782
AT1G67623 F-box family protein (.1) Lus10022147 26.8 0.7782
Lus10024550 30.0 0.7782
AT4G10020 ATHSD5 hydroxysteroid dehydrogenase 5... Lus10001280 32.9 0.7782
AT5G46795 MSP2 microspore-specific promoter ... Lus10004566 35.5 0.7782
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10010756 37.9 0.7782
Lus10010778 40.2 0.7782
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10012337 42.4 0.7782

Lus10031392 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.