Lus10031393 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G23730 387 / 1e-136 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G14130 384 / 3e-135 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT5G57560 381 / 3e-134 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G25810 365 / 9e-128 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 362 / 8e-127 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT4G30270 355 / 2e-124 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57540 339 / 7e-118 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57530 339 / 8e-118 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G48070 338 / 2e-117 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT4G25820 338 / 4e-117 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010939 577 / 0 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031392 573 / 0 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 570 / 0 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10010936 538 / 0 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 531 / 0 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10034098 525 / 0 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 443 / 1e-158 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 440 / 2e-157 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020772 440 / 3e-157 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G201250 452 / 3e-162 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201200 447 / 4e-160 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 444 / 5e-159 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 424 / 5e-151 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.014G146100 412 / 3e-146 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 405 / 1e-143 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 387 / 1e-136 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095100 374 / 1e-131 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 375 / 6e-131 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 372 / 2e-130 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10031393 pacid=23156016 polypeptide=Lus10031393 locus=Lus10031393.g ID=Lus10031393.BGIv1.0 annot-version=v1.0
ATGGCGATCGGCAGTACTCTGCCTCTGGTAATGTTAGTGGTGTTGGTGTGTCATCTAACGGCCATCTCAAATGCAAACTTCCACCAGCATTTCGACGTCA
CATGGGGTCAGCACCATGCTCAGATCATGAACACCGGCCAGCAGTTGACCCTCTCCCTCGACAAGGATTCCGGTGCCGGATTCAAGTCCAAAAACGAGTA
TCTTTTCGGCCGTATCGATATGCAACTCAAGCTCATAGCCGGCAACTCCGCCGGAAGTGTCACCACATTTTATTTGTCGTCAGAAGGACCGAACCACGAT
GAAATCGACTTCGAATTCCTTGGCAATTCCACCGGAAACCCTTACACTCTCCACACCAATGTGTTCAGCCAAGGAAAAGGTAACAGAGAACAACAATTTC
ACCTCTGGTTCGACCCAACTGCCGCTTTCCACACCTACACCATCCTCTGGAATTCCCAACGAATCATATTCTTGGTGGACAACATCCCCATCAGAGTGTT
CAACAACTTGGAATCAATGGGAGTGCCATTCCCAAACAAGCAGCCGATGAGCATTCACTCTAGCTTATGGAACGCCGATGACTGGGCTACCCAAGGCGGC
CGAGTGAAGGCTGATTGGACCAAAGCTCCCTTCATAGCTTCTTACAGGAACTTCAAAGCAGAAGCTTGTGTTTGGTCGCCGTCCTCTGCTTCTTCAACGT
GCACTCCGGGAGCATGGCAGACACAGGGGATCGATGCCGCCGGCCGGAATAGGATCCGGTGGGTGCAGAGTAAATATATGATCTATAATTACTGCACTGA
CTTGAAACGATTCCCTCAAGGAGTTCCAGTTGAATGCAAGCAGACCAGATTCCTTTAA
AA sequence
>Lus10031393 pacid=23156016 polypeptide=Lus10031393 locus=Lus10031393.g ID=Lus10031393.BGIv1.0 annot-version=v1.0
MAIGSTLPLVMLVVLVCHLTAISNANFHQHFDVTWGQHHAQIMNTGQQLTLSLDKDSGAGFKSKNEYLFGRIDMQLKLIAGNSAGSVTTFYLSSEGPNHD
EIDFEFLGNSTGNPYTLHTNVFSQGKGNREQQFHLWFDPTAAFHTYTILWNSQRIIFLVDNIPIRVFNNLESMGVPFPNKQPMSIHSSLWNADDWATQGG
RVKADWTKAPFIASYRNFKAEACVWSPSSASSTCTPGAWQTQGIDAAGRNRIRWVQSKYMIYNYCTDLKRFPQGVPVECKQTRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10031393 0 1
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10031392 1.0 0.9291
AT3G10520 ATGLB2, ARATHGL... NON-SYMBIOTIC HAEMOGLOBIN 2, A... Lus10038655 5.1 0.8209
AT4G18590 Nucleic acid-binding, OB-fold-... Lus10022705 7.3 0.8049
Lus10001343 7.7 0.7986
AT3G26330 CYP71B37 "cytochrome P450, family 71, s... Lus10033564 8.4 0.7795
AT2G44060 Late embryogenesis abundant pr... Lus10019367 9.2 0.7770
AT5G08640 ATFLS1, FLS flavonol synthase 1 (.1.2) Lus10023601 12.3 0.7628
AT2G18980 Peroxidase superfamily protein... Lus10001622 14.0 0.7265
AT1G01420 UGT72B3 UDP-glucosyl transferase 72B3 ... Lus10005334 14.8 0.7335
AT4G21520 Transducin/WD40 repeat-like su... Lus10002602 15.1 0.7330

Lus10031393 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.