Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56310 89 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010930 [exp] 129 / 1e-36 AT1G56310 640 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10022376 [exp] 38 / 0.0003 AT5G24340 544 / 0.0 3'-5' exonuclease domain-containing protein (.1) Lus10015114 [exp] 37 / 0.0005 AT2G32415 1089 / 0.0 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain (.1.2) Lus10031563 [exp] 37 / 0.0009 AT2G32415 1039 / 0.0 Polynucleotidyl transferase, ribonuclease H fold protein with HRDC domain (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G020000 [exp] 102 / 4e-27 AT1G56310 655 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.015G009500 [exp] 38 / 0.0002 AT5G24340 679 / 0.0 3'-5' exonuclease domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [flax] [poplar] RNase_H PF01612 [flax] [poplar] DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence Show only first row Show all	>Lus10031404 pacid=23155775 polypeptide=Lus10031404 locus=Lus10031404.g ID=Lus10031404.BGIv1.0 annot-version=v1.0 ATGGGAGCAGGGCTAAACAAGACCAGGCGAAATAGCAACTGGGAGTCTCGACCACTAAGCCAGAACCAGCTTGAGTATGCAGCTCTGGACGCGGCTGTAC TGGTTCACATATTCCACAGAGCTCGTAACCCTAGTCAGTCCACTTCGGCTACACAAGACGATGAGAAATTCGAGTGGAAATCTCACATTGTAAGTGCCCT TGCTTTCATCTTTCACACCACCTTTGTTAGTTGTCTCCCTTACCTTTAA
AA sequence Show only first row Show all	>Lus10031404 pacid=23155775 polypeptide=Lus10031404 locus=Lus10031404.g ID=Lus10031404.BGIv1.0 annot-version=v1.0 MGAGLNKTRRNSNWESRPLSQNQLEYAALDAAVLVHIFHRARNPSQSTSATQDDEKFEWKSHIVSALAFIFHTTFVSCLPYL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G56310			Polynucleotidyl transferase, r...		Lus10031404 [exp]	0	1
AT1G67080		ABA4	abscisic acid (aba)-deficient ...		Lus10028476 [exp]	1.4	0.8289
AT1G65420		NPQ7	NONPHOTOCHEMICAL QUENCHING 7, ...		Lus10039937 [exp]	7.3	0.8248
AT4G36850			PQ-loop repeat family protein ...		Lus10022491 [exp]	7.5	0.7551
AT5G23190		CYP86B1	"cytochrome P450, family 86, s...		Lus10040986 [exp]	7.5	0.7550
AT3G29270			RING/U-box superfamily protein...		Lus10015732 [exp]	12.2	0.7618
AT4G19150			Ankyrin repeat family protein ...		Lus10001414 [exp]	13.0	0.7581
AT1G26180			unknown protein		Lus10031917 [exp]	13.1	0.7522
AT5G58003		CPL4	C-terminal domain phosphatase-...		Lus10037233 [exp]	13.9	0.7340
AT1G03180			unknown protein		Lus10000654 [exp]	14.6	0.7733
AT3G05870		APC11	anaphase-promoting complex/cyc...		Lus10015126 [exp]	14.8	0.7993

Compare expression of checked genes

Lus10031404 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.