Lus10031408 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02080 360 / 7e-129 ASAR1, ATSARA1C, ATSAR2 secretion-associated RAS super family 2 (.1)
AT1G56330 357 / 2e-127 ATSAR1B, ATSAR1, SAR1, ATSARA1B ARABIDOPSIS THALIANA SECRETION-ASSOCIATED RAS 1B, secretion-associated RAS 1B (.1)
AT3G62560 356 / 3e-127 Ras-related small GTP-binding family protein (.1)
AT1G09180 332 / 1e-117 ATSARA1A, ATSAR1 SECRETION-ASSOCIATED RAS 1, secretion-associated RAS super family 1 (.1)
AT1G02620 184 / 1e-60 Ras-related small GTP-binding family protein (.1)
AT2G24765 89 / 3e-22 ARF3, ARL1, ATARL1 ARF-LIKE 1, ADP-ribosylation factor 3 (.1.2)
AT3G49870 87 / 2e-21 ATARLA1C ADP-ribosylation factor-like A1C (.1)
AT5G67560 82 / 9e-20 ATARLA1D ADP-ribosylation factor-like A1D (.1)
AT2G47170 81 / 2e-19 ARF1A1C, ARF1 Ras-related small GTP-binding family protein (.1)
AT3G62290 81 / 3e-19 ATARFA1E ADP-ribosylation factor A1E (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010926 372 / 8e-134 AT4G02080 385 / 9e-139 secretion-associated RAS super family 2 (.1)
Lus10037739 357 / 8e-128 AT4G02080 389 / 2e-140 secretion-associated RAS super family 2 (.1)
Lus10036456 354 / 2e-126 AT4G02080 386 / 3e-139 secretion-associated RAS super family 2 (.1)
Lus10016874 351 / 4e-125 AT4G02080 383 / 7e-138 secretion-associated RAS super family 2 (.1)
Lus10041127 337 / 3e-119 AT4G02080 369 / 1e-131 secretion-associated RAS super family 2 (.1)
Lus10002817 82 / 2e-19 AT2G15310 273 / 1e-94 ADP-ribosylation factor B1A (.1)
Lus10031436 81 / 3e-19 AT5G14670 368 / 2e-132 ADP-ribosylation factor A1B (.1)
Lus10030884 81 / 8e-19 AT5G14670 371 / 4e-133 ADP-ribosylation factor A1B (.1)
Lus10001524 80 / 1e-18 AT1G10630 372 / 3e-133 ADP-ribosylation factor A1F (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G019100 356 / 3e-127 AT4G02080 357 / 1e-127 secretion-associated RAS super family 2 (.1)
Potri.010G141900 355 / 4e-127 AT4G02080 384 / 3e-138 secretion-associated RAS super family 2 (.1)
Potri.013G009900 354 / 2e-126 AT4G02080 308 / 3e-108 secretion-associated RAS super family 2 (.1)
Potri.013G010000 352 / 1e-125 AT4G02080 308 / 3e-108 secretion-associated RAS super family 2 (.1)
Potri.008G107800 350 / 3e-125 AT4G02080 338 / 4e-120 secretion-associated RAS super family 2 (.1)
Potri.005G015400 343 / 4e-122 AT4G02080 299 / 7e-105 secretion-associated RAS super family 2 (.1)
Potri.006G171500 88 / 7e-22 AT2G24765 353 / 8e-127 ARF-LIKE 1, ADP-ribosylation factor 3 (.1.2)
Potri.006G267800 87 / 1e-21 AT2G24765 333 / 8e-119 ARF-LIKE 1, ADP-ribosylation factor 3 (.1.2)
Potri.018G096077 87 / 1e-21 AT2G24765 354 / 8e-127 ARF-LIKE 1, ADP-ribosylation factor 3 (.1.2)
Potri.018G013700 87 / 1e-21 AT2G24765 336 / 6e-120 ARF-LIKE 1, ADP-ribosylation factor 3 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00025 Arf ADP-ribosylation factor family
Representative CDS sequence
>Lus10031408 pacid=23155804 polypeptide=Lus10031408 locus=Lus10031408.g ID=Lus10031408.BGIv1.0 annot-version=v1.0
ATGTTTCTGATCGATTGGTTCTACGGAGTTCTCGCATCGCTCGGTCTGTGGCAGAAGGAAGCCAAGATCTTGTTCCTCGGCCTCGATAATGCCGGGAAAA
CCACTCTTCTCCACATGTTGAAAGATGAGAGGCTAGTGCAGCATCAGCCGACTCAGTACCCGACTTCTGAAGAGCTGAGCATTGGGAAAATCAAGTTCAA
GGCTTTTGATCTTGGTGGTCACCAGATTGCTCGTAGAGTCTGGAAAGATTACTATGCTAAGGTGGATGCTGTGGTATATTTGGTGGATGCATTCGACAAG
GAAAGATTCGCAGAGTCCAAGAAAGAACTCGACGCACTCCTCTCCGACGAGTCACTCTCCACTGTCCCTTTCCTGATACTCGGGAACAAGATCGACATAC
CATATGCTGCCTCGGAAGATGAGCTTCGTTACCACTTGGGGCTCACAAACTTCACCACCGGCAAGGGCAAGGTGAATTTGAGTGACACGAATGTCCGCCC
CCTCGAGGTGTTCATGTGCAGCATCGTCCGCAAAATGGGCTACGGGGAAGGGTTCAAGTGGATGTCTCAGTACATCAACTAG
AA sequence
>Lus10031408 pacid=23155804 polypeptide=Lus10031408 locus=Lus10031408.g ID=Lus10031408.BGIv1.0 annot-version=v1.0
MFLIDWFYGVLASLGLWQKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAFDK
ERFAESKKELDALLSDESLSTVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVNLSDTNVRPLEVFMCSIVRKMGYGEGFKWMSQYIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02080 ASAR1, ATSARA1C... secretion-associated RAS super... Lus10031408 0 1
AT4G14950 KMS1 Killing Me Slowly 1, SNARE ass... Lus10010536 2.0 0.9133
AT1G24450 NFD2 NUCLEAR FUSION DEFECTIVE 2, Ri... Lus10002362 2.6 0.9114
AT5G03460 unknown protein Lus10023922 3.2 0.9129
AT1G19360 RRA3 reduced residual arabinose 3, ... Lus10018812 6.0 0.8945
AT5G13160 PBS1 avrPphB susceptible 1, Protein... Lus10015756 6.3 0.8741
AT1G19360 RRA3 reduced residual arabinose 3, ... Lus10032710 7.7 0.8908
AT4G27130 Translation initiation factor ... Lus10027181 8.1 0.9195
AT5G27320 ATGID1C, GID1C GA INSENSITIVE DWARF1C, alpha/... Lus10000928 8.1 0.8844
AT1G01050 ATPPA1 pyrophosphorylase 1 (.1) Lus10014292 8.7 0.8869
AT3G03610 ELMO/CED-12 family protein (.1... Lus10009523 10.4 0.9147

Lus10031408 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.