Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06540 123 / 2e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G48910 122 / 6e-34 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G08070 118 / 1e-32 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G33170 117 / 3e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 115 / 2e-31 pentatricopeptide (PPR) repeat-containing protein (.1) AT4G21065 114 / 2e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT3G08820 112 / 1e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G02980 112 / 1e-30 OTP85 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G37380 112 / 2e-30 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G47530 111 / 3e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010908 [exp] 163 / 6e-49 AT5G48910 410 / 5e-135 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10010909 [exp] 147 / 7e-43 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031423 [exp] 144 / 5e-42 AT5G66520 538 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10033026 [exp] 123 / 3e-34 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030053 [exp] 122 / 4e-34 AT1G08070 884 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014298 [exp] 119 / 8e-33 AT5G66520 748 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027561 [exp] 108 / 1e-32 AT3G49142 155 / 1e-45 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024971 [exp] 117 / 3e-32 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000110 [exp] 113 / 3e-32 AT4G37380 413 / 9e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G191200 [exp] 123 / 2e-34 AT5G48910 852 / 0.0 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G012600 [exp] 122 / 6e-34 AT2G29760 540 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G040100 [exp] 120 / 2e-33 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G252400 [exp] 118 / 4e-33 AT4G21065 496 / 8e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.013G044700 [exp] 118 / 1e-32 AT3G22690 582 / 0.0 unknown protein Potri.010G168800 [exp] 116 / 4e-32 AT2G02980 860 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.017G001000 [exp] 115 / 8e-32 AT4G21065 793 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.007G050200 [exp] 115 / 2e-31 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G071800 [exp] 114 / 3e-31 AT1G08070 606 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G011000 [exp] 113 / 6e-31 AT1G08070 572 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031424 pacid=23155998 polypeptide=Lus10031424 locus=Lus10031424.g ID=Lus10031424.BGIv1.0 annot-version=v1.0 ATGCTGGACGTGGAGGAAGAGGAGGATCGGAGCGTGATGCGGTACCACAGCAAGAAGGTGGCGATTGCGTTCGGGTTGATTAGCACGAAGCCCGGGACGA CGATAAGGGTGGTGAAGAATTTGAGGGTTTGTGATGATTGTCACTCTGCTGTGAAGATGATCTCTCGAGTTTATGGTCGAGACATTATAGTGAGGGATCG GGTGAGGTACCATGAGTTCAGCAATGGTGCTTGTTCTTGTAATGACCGTTGGTAA
AA sequence Show only first row Show all	>Lus10031424 pacid=23155998 polypeptide=Lus10031424 locus=Lus10031424.g ID=Lus10031424.BGIv1.0 annot-version=v1.0 MLDVEEEEDRSVMRYHSKKVAIAFGLISTKPGTTIRVVKNLRVCDDCHSAVKMISRVYGRDIIVRDRVRYHEFSNGACSCNDRW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06540			Pentatricopeptide repeat (PPR)...		Lus10031424 [exp]	0	1
					Lus10018970 [exp]	1.0	0.9166
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10023453 [exp]	1.4	0.9103
AT2G44820			unknown protein		Lus10026825 [exp]	2.2	0.8890
AT1G61420			S-locus lectin protein kinase ...		Lus10019600 [exp]	2.4	0.8838
AT1G50420	GRAS	SCL-3, SCL3	scarecrow-like 3 (.1)		Lus10016892 [exp]	2.8	0.8972
AT1G02000		GAE2	UDP-D-glucuronate 4-epimerase ...		Lus10031707 [exp]	4.5	0.8384
					Lus10015488 [exp]	5.5	0.9005
AT3G45070			P-loop containing nucleoside t...		Lus10003068 [exp]	8.5	0.8747
AT5G24860		ATFPF1, FPF1	ARABIDOPSIS FLOWERING PROMOTIN...		Lus10037510 [exp]	8.8	0.8505
AT4G13750		EMB2597, NOV	NO VEIN, EMBRYO DEFECTIVE 2597...		Lus10022572 [exp]	9.2	0.8775

Compare expression of checked genes

Lus10031424 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.