Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09250 50 / 1e-08 bHLH bHLH149, AIF4 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) AT3G17100 50 / 2e-08 bHLH bHLH147, AIF3 sequence-specific DNA binding transcription factors (.1.2) AT3G06590 40 / 4e-05 bHLH bHLH148, AIF2 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) AT3G05800 39 / 0.0001 bHLH bHLH150, AIF1 AtBS1(activation-tagged BRI1 suppressor 1)-interacting factor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017065 [exp] 52 / 5e-09 AT3G06590 171 / 1e-53 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10037783 [exp] 52 / 5e-09 AT3G06590 172 / 9e-54 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G012400 [exp] 58 / 1e-11 AT1G09250 109 / 1e-29 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.013G007700 [exp] 55 / 3e-10 AT1G09250 95 / 4e-24 basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1) Potri.008G103500 [exp] 53 / 1e-09 AT3G17100 174 / 2e-54 sequence-specific DNA binding transcription factors (.1.2) Potri.010G147400 [exp] 50 / 2e-08 AT3G17100 174 / 3e-54 sequence-specific DNA binding transcription factors (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031425 pacid=23155857 polypeptide=Lus10031425 locus=Lus10031425.g ID=Lus10031425.BGIv1.0 annot-version=v1.0 ATGGCGTCGATGATAGGAACCGATCCGGAATTGAGTACTACAGACAGATCGGAAGAGCGTCGTGTAGGGAAGAGGAGAGTTAGAGTGATCGGAGAGGCGA TTCGGAGGAACCAGAAGTTTATTGTGTCGATGGAGGAGGAGGAGGAGGAGACGAGTAATTCTCCGCCGGCGGTGGAGAAGAAAATCCGGACGTTGAGCCG GCTGGTTCCTGGTTGCCGGAAGGCACCGTTGACGAATTTGTTGGAGGAGGTGGGGGGGTTCATCGGGGGAGTAGAGAAGCAAGGCAATTGA
AA sequence Show only first row Show all	>Lus10031425 pacid=23155857 polypeptide=Lus10031425 locus=Lus10031425.g ID=Lus10031425.BGIv1.0 annot-version=v1.0 MASMIGTDPELSTTDRSEERRVGKRRVRVIGEAIRRNQKFIVSMEEEEEETSNSPPAVEKKIRTLSRLVPGCRKAPLTNLLEEVGGFIGGVEKQGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09250	bHLH	bHLH149, AIF4	basic helix-loop-helix (bHLH) ...		Lus10031425 [exp]	0	1
AT1G25550	GARP		myb-like transcription factor ...		Lus10034280 [exp]	1.0	0.7637
AT1G62310			transcription factor jumonji (...		Lus10020033 [exp]	16.9	0.7312
AT3G10960		ATAZG1	AZA-guanine resistant1 (.1)		Lus10030548 [exp]	23.2	0.6885
AT3G52440	DOF	AtDof3,5	Dof-type zinc finger DNA-bindi...		Lus10013586 [exp]	31.0	0.7238
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10014103 [exp]	32.6	0.7033
AT2G39910			ARM repeat superfamily protein...		Lus10040233 [exp]	59.2	0.6932
AT1G49230			RING/U-box superfamily protein...		Lus10033515 [exp]	70.8	0.6925
AT5G21050			unknown protein		Lus10019547 [exp]	90.3	0.6563
AT4G32010	B3	HSL1, HSI2-L1, ...	VP1/ABI3-LIKE 2, HSI2-like 1 (...		Lus10025226 [exp]	113.8	0.6697
AT1G29040			unknown protein		Lus10000987 [exp]	122.5	0.6751

Compare expression of checked genes

Lus10031425 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.