Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26620 51 / 4e-10 unknown protein AT3G05858 47 / 4e-08 unknown protein AT1G48325 35 / 0.0007 Expressed protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001512 [exp] 130 / 5e-41 AT5G26620 53 / 1e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G001900 [exp] 52 / 2e-10 AT3G05858 55 / 3e-11 unknown protein Potri.013G001800 [exp] 52 / 2e-10 AT3G05858 55 / 3e-11 unknown protein Potri.013G002000 [exp] 52 / 3e-10 AT3G05858 54 / 5e-11 unknown protein Potri.005G002600 [exp] 52 / 4e-10 AT5G26620 49 / 4e-09 unknown protein Potri.005G002500 [exp] 52 / 4e-10 AT5G26620 49 / 4e-09 unknown protein Potri.010G003900 [exp] 44 / 3e-07 AT3G05858 72 / 5e-18 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031447 pacid=23155868 polypeptide=Lus10031447 locus=Lus10031447.g ID=Lus10031447.BGIv1.0 annot-version=v1.0 ATGGGAGGTAAGGGGAAATCGTCGTCCAAGTCAGGGGGCTCATTCACTTCGGTGTTCAGCCAGCTGTTCAGGCGAGGAGGCGGCCGGCGATCCTCCTCGT CGTACTACGGAGACGACGACCAGGTGCACGGTGGATGGAGGGCGTGGACTAGCGACGAGGACAAAGCAGGGAGATACGTGGCGGACCCTCGTATCGACAC GAAGGCTTCTGCTTTCATCGCTCACTTCCATGCCGCTCGCTTCTCCGAATCCGAACAGAAGATTTTCCAATGCGCCAACTGA
AA sequence Show only first row Show all	>Lus10031447 pacid=23155868 polypeptide=Lus10031447 locus=Lus10031447.g ID=Lus10031447.BGIv1.0 annot-version=v1.0 MGGKGKSSSKSGGSFTSVFSQLFRRGGGRRSSSSYYGDDDQVHGGWRAWTSDEDKAGRYVADPRIDTKASAFIAHFHAARFSESEQKIFQCAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G26620			unknown protein		Lus10031447 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10010713 [exp]	2.2	0.8154
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016498 [exp]	8.0	0.7013
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10030840 [exp]	11.3	0.7653
					Lus10021443 [exp]	14.1	0.7332
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10033741 [exp]	17.9	0.7512
AT1G28110		SCPL45	serine carboxypeptidase-like 4...		Lus10013395 [exp]	19.9	0.7591
AT5G02890			HXXXD-type acyl-transferase fa...		Lus10040156 [exp]	20.2	0.7653
AT4G24140		BDG3	alpha/beta-Hydrolases superfam...		Lus10008266 [exp]	26.0	0.7060
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10035903 [exp]	28.1	0.7282
AT1G11340			S-locus lectin protein kinase ...		Lus10007611 [exp]	29.8	0.7320

Compare expression of checked genes

Lus10031447 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.