Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G42150 103 / 8e-31 unknown protein AT1G21930 103 / 2e-30 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011614 [exp] 156 / 1e-50 AT3G42150 132 / 2e-40 unknown protein Lus10017643 [exp] 132 / 5e-42 AT3G42150 130 / 4e-41 unknown protein Lus10033601 [exp] 128 / 9e-39 ND 111 / 2e-31
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G086300 [exp] 119 / 8e-37 AT1G21930 140 / 4e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031451 pacid=23155810 polypeptide=Lus10031451 locus=Lus10031451.g ID=Lus10031451.BGIv1.0 annot-version=v1.0 ATGGGGACATGGTTCTTTTCGGCAGCTGGGGCACTGATAGCGATTCCAGTTGGGATAAAGAAGAAGTCGTTAGCTCCACTGGTGTTCTTTGGCACGACGG GGACGATGCTCGATATGATAATGGGTATCAGCCAGTGTGAAAGACAGCATGCAGAGCGCCAAGCAATGCTACTAGAAACCCAGAATGCTGCACCAGTTGA TGGAGAGTTTTCGGCAACTGGATCTTCGGACTCTTGA
AA sequence Show only first row Show all	>Lus10031451 pacid=23155810 polypeptide=Lus10031451 locus=Lus10031451.g ID=Lus10031451.BGIv1.0 annot-version=v1.0 MGTWFFSAAGALIAIPVGIKKKSLAPLVFFGTTGTMLDMIMGISQCERQHAERQAMLLETQNAAPVDGEFSATGSSDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G42150			unknown protein		Lus10031451 [exp]	0	1
AT1G31860		HISN2, AT-IE	HISTIDINE BIOSYNTHESIS 2, hist...		Lus10043483 [exp]	2.2	0.8536
					Lus10011631 [exp]	3.7	0.8489
AT4G03230			S-locus lectin protein kinase ...		Lus10033752 [exp]	4.2	0.8459
					Lus10007903 [exp]	4.5	0.8331
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10038667 [exp]	4.7	0.7822
AT2G19130			S-locus lectin protein kinase ...		Lus10018537 [exp]	7.9	0.7848
AT2G38940		PHT1;4, ATPT2	ARABIDOPSIS THALIANA PHOSPHATE...		Lus10033866 [exp]	8.4	0.8281
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10039772 [exp]	12.8	0.7195
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028942 [exp]	13.5	0.8186
AT2G31100			alpha/beta-Hydrolases superfam...		Lus10000983 [exp]	13.6	0.7237

Compare expression of checked genes

Lus10031451 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.