Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G26930 60 / 3e-12 GATA GATA23 GATA transcription factor 23 (.1) AT5G49300 59 / 1e-11 GATA GATA16 GATA transcription factor 16 (.1) AT4G36620 60 / 2e-11 GATA GATA19, HANL2 hanaba taranu like 2, GATA transcription factor 19 (.1) AT2G18380 60 / 2e-11 GATA GATA20, HANL1 hanaba taranu like 1, GATA transcription factor 20 (.1) AT3G50870 60 / 4e-11 GATA GATA18, HAN, MNP MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) AT3G06740 58 / 4e-11 GATA GATA15 GATA transcription factor 15 (.1) AT5G56860 59 / 2e-10 GATA GATA21, GNC GATA, nitrate-inducible, carbon metabolism-involved, GATA TRANSCRIPTION FACTOR 21, GATA type zinc finger transcription factor family protein (.1) AT4G26150 58 / 2e-10 GATA GATA22, CGA1, GNL GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) AT4G16141 57 / 2e-10 GATA GATA type zinc finger transcription factor family protein (.1) AT3G16870 56 / 7e-10 GATA GATA17 GATA transcription factor 17 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029863 [exp] 66 / 1e-13 AT4G16141 90 / 1e-22 GATA type zinc finger transcription factor family protein (.1) Lus10020684 [exp] 64 / 1e-12 AT4G16141 94 / 9e-24 GATA type zinc finger transcription factor family protein (.1) Lus10037721 [exp] 61 / 4e-12 AT3G06740 153 / 2e-48 GATA transcription factor 15 (.1) Lus10016849 [exp] 61 / 5e-12 AT3G06740 154 / 6e-49 GATA transcription factor 15 (.1) Lus10010027 [exp] 59 / 2e-11 AT5G49300 87 / 8e-23 GATA transcription factor 16 (.1) Lus10028301 [exp] 59 / 4e-11 AT3G50870 135 / 4e-39 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Lus10036329 [exp] 59 / 2e-10 AT1G02700 189 / 1e-57 unknown protein Lus10037994 [exp] 52 / 3e-08 AT3G54810 160 / 6e-46 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2) Lus10009227 [exp] 52 / 3e-08 AT3G54810 162 / 8e-47 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G020500 [exp] 67 / 3e-14 AT3G06740 67 / 1e-14 GATA transcription factor 15 (.1) Potri.008G213900 [exp] 59 / 1e-11 AT3G06740 126 / 4e-38 GATA transcription factor 15 (.1) Potri.010G001300 [exp] 59 / 1e-11 AT3G06740 135 / 2e-41 GATA transcription factor 15 (.1) Potri.006G229200 [exp] 61 / 2e-11 AT4G26150 111 / 3e-28 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.007G024500 [exp] 60 / 4e-11 AT3G50870 202 / 5e-64 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.005G122700 [exp] 60 / 4e-11 AT3G50870 198 / 1e-62 MONOPOLE, HANABA TANARU, GATA TRANSCRIPTION FACTOR 18, GATA type zinc finger transcription factor family protein (.1) Potri.014G124400 [exp] 57 / 5e-11 AT5G49300 106 / 2e-30 GATA transcription factor 16 (.1) Potri.002G199800 [exp] 56 / 2e-10 AT5G49300 112 / 1e-32 GATA transcription factor 16 (.1) Potri.018G053600 [exp] 57 / 4e-10 AT4G26150 75 / 4e-15 GNC-LIKE, GATA TRANSCRIPTION FACTOR 22, cytokinin-responsive gata factor 1 (.1) Potri.008G038900 [exp] 54 / 5e-09 AT3G54810 150 / 1e-42 GATA TRANSCRIPTION FACTOR 8, BLUE MICROPYLAR END 3-ZINC FINGER, BLUE MICROPYLAR END 3, Plant-specific GATA-type zinc finger transcription factor family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00320 [flax] [poplar] GATA GATA zinc finger
Representative CDS sequence Show only first row Show all	>Lus10031464 pacid=23155880 polypeptide=Lus10031464 locus=Lus10031464.g ID=Lus10031464.BGIv1.0 annot-version=v1.0 ATGAAGGTACTACAAAATTCCACTGAGAAATCGTTGGTTTTCGGCGACGAAGAACAAAAGAAGGAGAAGGAGATGCAGAAATCCTGCCGCGATTGTAAAG CTACGAGTACGCCCTTGTGGAGATTCGGCCCCGCCGGCCCCAAGTCGCTCTGCAACGCTTGCGGGATCAGATACGCGAAGAAGATAAGACCGGACAAAAA GCAAGCCAACTCGCCGTCACCGCCGCAGCAGATCGCCTCTTCCTCCTCCGCCGCCGGGACTACCAGCGACGAACCCAGTTCATCACCGACGGGACCGTTG AAAGTGAGGGTGGTGTATTCGAGCCCCAAGGGAGGAGTGATGTTCCGGCGATCTCTGCTGCGGGCGCCGCCGACGCCGGCGATGGTGGTGAAGAAACAGA AGTATGGTAAGAGGAAGGTACGGAAGCTGACGGAGGAAGAAGTACAAGCTGCTCGTTGCTTAGTGGCTCTCTCCAGCTGCTCAGATTTTGCTTAG
AA sequence Show only first row Show all	>Lus10031464 pacid=23155880 polypeptide=Lus10031464 locus=Lus10031464.g ID=Lus10031464.BGIv1.0 annot-version=v1.0 MKVLQNSTEKSLVFGDEEQKKEKEMQKSCRDCKATSTPLWRFGPAGPKSLCNACGIRYAKKIRPDKKQANSPSPPQQIASSSSAAGTTSDEPSSSPTGPL KVRVVYSSPKGGVMFRRSLLRAPPTPAMVVKKQKYGKRKVRKLTEEEVQAARCLVALSSCSDFA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24050	GATA	GATA1	GATA transcription factor 1 (....		Lus10031464 [exp]	0	1
AT3G51680		AtSDR2	short-chain dehydrogenase/redu...		Lus10016996 [exp]	3.9	0.8265
AT2G31980		AtCYS2	PHYTOCYSTATIN 2 (.1)		Lus10041257 [exp]	5.1	0.7936
AT4G28560		RIC7	ROP-interactive CRIB motif-con...		Lus10003624 [exp]	7.7	0.7813
AT5G18590			Galactose oxidase/kelch repeat...		Lus10034163 [exp]	15.5	0.7717
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10019871 [exp]	15.7	0.7916
					Lus10002011 [exp]	20.0	0.7916
AT3G19184	B3		AP2/B3-like transcriptional fa...		Lus10014043 [exp]	26.2	0.7799
AT1G05970			RNA-binding (RRM/RBD/RNP motif...		Lus10033646 [exp]	29.0	0.7447
AT2G39170			unknown protein		Lus10037961 [exp]	31.5	0.6558
AT4G37740	GRF	ATGRF2	growth-regulating factor 2 (.1...		Lus10008916 [exp]	32.7	0.6376

Compare expression of checked genes

Lus10031464 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.