Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56240 77 / 2e-18 ATPP2-B13 phloem protein 2-B13 (.1) AT1G56250 71 / 2e-16 ATPP2-B14 phloem protein 2-B14 (.1) AT1G09155 64 / 8e-14 ATPP2-B15 phloem protein 2-B15 (.1) AT5G24560 54 / 3e-10 ATPP2-B12 phloem protein 2-B12 (.1) AT2G02240 50 / 1e-08 MEE66 maternal effect embryo arrest 66, F-box family protein (.1) AT1G80110 47 / 8e-08 ATPP2-B11 phloem protein 2-B11 (.1) AT2G02320 46 / 3e-07 ATPP2-B7 phloem protein 2-B7 (.1) AT2G02340 45 / 5e-07 ATPP2-B8 phloem protein 2-B8 (.1) AT2G02360 45 / 1e-06 ATPP2-B10 phloem protein 2-B10 (.1) AT2G02250 41 / 2e-05 ATPP2-B2 phloem protein 2-B2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031484 [exp] 119 / 5e-34 AT1G09155 260 / 1e-85 phloem protein 2-B15 (.1) Lus10015208 [exp] 117 / 6e-34 AT1G09155 270 / 2e-90 phloem protein 2-B15 (.1) Lus10020673 [exp] 88 / 2e-22 AT1G09155 272 / 2e-91 phloem protein 2-B15 (.1) Lus10029872 [exp] 85 / 2e-21 AT1G09155 272 / 3e-91 phloem protein 2-B15 (.1) Lus10020674 [exp] 82 / 1e-20 AT1G09155 266 / 7e-89 phloem protein 2-B15 (.1) Lus10015209 [exp] 59 / 1e-11 AT1G09155 209 / 1e-66 phloem protein 2-B15 (.1) Lus10031473 [exp] 53 / 1e-09 AT1G09155 228 / 1e-74 phloem protein 2-B15 (.1) Lus10029674 [exp] 52 / 2e-09 AT2G02230 237 / 2e-76 phloem protein 2-B1 (.1) Lus10042713 [exp] 50 / 1e-08 AT2G02230 235 / 1e-75 phloem protein 2-B1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G022000 [exp] 85 / 2e-21 AT1G09155 290 / 4e-98 phloem protein 2-B15 (.1) Potri.013G012600 [exp] 81 / 6e-20 AT1G09155 281 / 1e-94 phloem protein 2-B15 (.1) Potri.018G015800 [exp] 55 / 2e-10 AT2G02240 242 / 1e-78 maternal effect embryo arrest 66, F-box family protein (.1) Potri.013G012666 [exp] 50 / 6e-09 AT1G09155 120 / 2e-33 phloem protein 2-B15 (.1) Potri.001G050100 [exp] 49 / 2e-08 AT2G02360 219 / 5e-71 phloem protein 2-B10 (.1) Potri.006G267000 [exp] 49 / 2e-08 AT2G02240 239 / 1e-77 maternal effect embryo arrest 66, F-box family protein (.1) Potri.018G016100 [exp] 42 / 1e-05 AT2G02250 217 / 2e-69 phloem protein 2-B2 (.1) Potri.018G016000 [exp] 41 / 2e-05 AT2G02250 220 / 2e-70 phloem protein 2-B2 (.1) Potri.006G266900 [exp] 40 / 3e-05 AT2G02240 215 / 2e-68 maternal effect embryo arrest 66, F-box family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10031471 pacid=23155785 polypeptide=Lus10031471 locus=Lus10031471.g ID=Lus10031471.BGIv1.0 annot-version=v1.0 ATGATGGAGCGGCTGATGTACGGACACCGGACGGAGGTGTCGAAATTGTCGACGGTTGCCATGGCCGGAGGAGGGGAAGGGAGGTTGCCGGAGGAGAGGG GAGATGGGTGGTTGGAAGTTGAGATTGGTGAGTTTTGGAGTGGGGAAAGAGATGAAGAAGTTAGGATGAGTTTGAGGGAAGTGAAAGGTTACCATTTGAA AGGGGGGCTTGTTGTTCAAGGCATTGAAGTTAGGCCTAAACCCTAA
AA sequence Show only first row Show all	>Lus10031471 pacid=23155785 polypeptide=Lus10031471 locus=Lus10031471.g ID=Lus10031471.BGIv1.0 annot-version=v1.0 MMERLMYGHRTEVSKLSTVAMAGGGEGRLPEERGDGWLEVEIGEFWSGERDEEVRMSLREVKGYHLKGGLVVQGIEVRPKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G56240		ATPP2-B13	phloem protein 2-B13 (.1)		Lus10031471 [exp]	0	1
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10031473 [exp]	1.0	0.9838
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10031472 [exp]	1.4	0.9720
AT4G36500			unknown protein		Lus10014291 [exp]	2.2	0.9441
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10013589 [exp]	2.4	0.9570
AT2G24300			Calmodulin-binding protein (.1...		Lus10036301 [exp]	5.3	0.8991
AT1G09155		ATPP2-B15	phloem protein 2-B15 (.1)		Lus10015208 [exp]	5.7	0.9550
AT1G76650		CML38	calmodulin-like 38 (.1.2.3)		Lus10022343 [exp]	6.6	0.9153
AT3G59080			Eukaryotic aspartyl protease f...		Lus10007335 [exp]	9.5	0.9226
AT3G08760		ATSIK	Protein kinase superfamily pro...		Lus10014168 [exp]	10.2	0.9027
AT1G30755			Protein of unknown function (D...		Lus10017260 [exp]	11.8	0.8752

Compare expression of checked genes

Lus10031471 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.