Lus10031483 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G46940 65 / 3e-13 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT4G02250 57 / 3e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G55770 53 / 9e-09 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G64620 50 / 1e-07 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT5G46930 49 / 2e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G02550 49 / 6e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17230 48 / 1e-06 invertase/pectin methylesterase inhibitor family protein (.1)
AT5G46950 46 / 2e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G47340 47 / 3e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT5G46970 45 / 6e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015199 297 / 7e-104 AT5G46940 67 / 8e-14 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10029877 162 / 8e-51 AT5G64620 67 / 7e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10020664 157 / 4e-49 AT5G64620 67 / 2e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10008201 89 / 4e-22 AT4G02250 113 / 3e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10001464 88 / 8e-22 AT4G02250 112 / 1e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10019498 53 / 1e-08 AT5G46970 87 / 1e-21 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10003530 47 / 1e-06 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10002933 47 / 2e-06 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10043346 46 / 2e-06 AT5G46940 69 / 3e-15 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G134900 84 / 2e-20 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.004G016500 78 / 6e-18 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G191500 69 / 1e-14 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086600 68 / 3e-14 AT5G38610 123 / 2e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.014G044100 66 / 2e-13 AT5G46940 111 / 3e-31 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023100 67 / 3e-13 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023201 67 / 3e-13 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.005G023050 67 / 4e-13 AT5G46940 45 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.003G086500 65 / 5e-13 AT5G46940 119 / 6e-34 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.001G127500 64 / 6e-13 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10031483 pacid=23155848 polypeptide=Lus10031483 locus=Lus10031483.g ID=Lus10031483.BGIv1.0 annot-version=v1.0
ATGATCTTCACACTATGCCTCCTCTTCATTTCCATCACACCTCACCAATCCAATGCTCAAGCTCCAGCTCCAGCTCCGGCTTACACAACAACGACAACAA
CGACGACGACAACCGGTCCCACGATGTCGAAGCCGGAGCTGCTAAACAAAGCCTGTCACTGCAAATACAAGCCAGTGTGCATGGCCTTCCTCGGCTCCTT
CCCGGAGTCGGAGGTGAAGGACATGCACGGGCTGGCGGAATACGCGCTCAAGATGGTTGCCCTGAACGCGACCAAGGTCTACGGGGACATCAAGAAGATG
GAGGCCACGTCCACGGACGATGTGGTGCAGCAGAAGCTGAACGACTGCGGGGAGGATTATCAGGATGTCATTGATCAGTTCGAGGACTCGATGCCCGCGC
TGGACGCGAAGGCTTACGACAATGTGATCACGTTCATAACCGCGGCTATGAACGATGTCCAAGGTTGCGAAGACGGGTTCAAGCAGCCGCCCGTGGCTAA
GTCTCCCCTCACTGAGACTAATGATGCTGTGACACAGTTGTGCAATGTTTGTTTGTCCATTGTTAACATGGTTGGCAAGTAG
AA sequence
>Lus10031483 pacid=23155848 polypeptide=Lus10031483 locus=Lus10031483.g ID=Lus10031483.BGIv1.0 annot-version=v1.0
MIFTLCLLFISITPHQSNAQAPAPAPAYTTTTTTTTTTGPTMSKPELLNKACHCKYKPVCMAFLGSFPESEVKDMHGLAEYALKMVALNATKVYGDIKKM
EATSTDDVVQQKLNDCGEDYQDVIDQFEDSMPALDAKAYDNVITFITAAMNDVQGCEDGFKQPPVAKSPLTETNDAVTQLCNVCLSIVNMVGK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G46940 Plant invertase/pectin methyle... Lus10031483 0 1
Lus10010602 5.7 0.7081
Lus10025095 9.3 0.7835
Lus10025405 9.5 0.5918
AT1G28030 2-oxoglutarate (2OG) and Fe(II... Lus10012760 13.8 0.7657
Lus10007927 18.2 0.7505
AT3G19540 Protein of unknown function (D... Lus10028040 21.0 0.7505
Lus10023587 23.5 0.7505
AT1G48120 hydrolases;protein serine/thre... Lus10015869 25.7 0.7505
AT5G07610 F-box family protein (.1) Lus10042990 26.7 0.5745
AT4G12570 UPL5 ubiquitin protein ligase 5 (.1... Lus10039026 27.7 0.7505

Lus10031483 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.