Plant FIBer expression Database

Lus10031487 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G27820 120 / 1e-36 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015194
[exp]
155 / 2e-50 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G100900
[exp]
120 / 3e-36 AT5G27820 155 / 3e-50 Ribosomal L18p/L5e family protein (.1)
Potri.005G068300
[exp]
58 / 2e-12 AT5G27820 68 / 2e-16 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Lus10031487 pacid=23155906 polypeptide=Lus10031487 locus=Lus10031487.g ID=Lus10031487.BGIv1.0 annot-version=v1.0
ATGGTGATTCCACCAGCAATGAGACCACCAAGGATCACAGAGTATCTGAAGCCCTATGTGCTGAAGATGCATTTCAGCAACAAGTATGTTTCAGCGACGG
TGGTCCACACACCAACTGCAACTGTCGCGTCCTCTGCAAGCTCGCAAGAGAAGACCCTGAGGACAGTCATGGGAAACACTCGTGATGTTGCAGCTGCTGC
CAAAATCGGTAAGCTTCTAGGAGAGCGCCTGCTGCTGAAAGGGATACCGGCTGTTTCGATTCTGCTGAAGAGGGAACAGAAGTATCATGGTAAGATTAAG
GCTATTGTTGATTCCGTTAGGGAATCTGGCGTTAAGCTTATCTAG
AA sequence
>Lus10031487 pacid=23155906 polypeptide=Lus10031487 locus=Lus10031487.g ID=Lus10031487.BGIv1.0 annot-version=v1.0
MVIPPAMRPPRITEYLKPYVLKMHFSNKYVSATVVHTPTATVASSASSQEKTLRTVMGNTRDVAAAAKIGKLLGERLLLKGIPAVSILLKREQKYHGKIK
AIVDSVRESGVKLI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27820 Ribosomal L18p/L5e family prot... Lus10031487
[exp]
0 1
AT1G73770 unknown protein Lus10013498
[exp]
4.6 0.7214
AT3G22660 rRNA processing protein-relate... Lus10031698
[exp]
7.2 0.7240
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Lus10009322
[exp]
11.9 0.7473
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10031705
[exp]
15.1 0.6980
AT1G54850 HSP20-like chaperones superfam... Lus10035725
[exp]
16.9 0.7151
AT2G33845 Nucleic acid-binding, OB-fold-... Lus10039889
[exp]
23.2 0.7149
AT1G16350 Aldolase-type TIM barrel famil... Lus10000276
[exp]
25.9 0.6631
AT1G03510 Tetratricopeptide repeat (TPR)... Lus10018543
[exp]
26.2 0.6496
AT2G47990 SWA1, EDA13, ED... SLOW WALKER1, EMBRYO SAC DEVEL... Lus10017890
[exp]
27.4 0.6833
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10039528
[exp]
28.8 0.6758

Lus10031487 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.