Lus10031488 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G56220 120 / 2e-36 Dormancy/auxin associated family protein (.1.2.3.4)
AT1G54070 51 / 8e-09 Dormancy/auxin associated family protein (.1)
AT1G28330 47 / 2e-07 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
AT5G44300 38 / 0.0003 Dormancy/auxin associated family protein (.1)
AT2G33830 37 / 0.0007 Dormancy/auxin associated family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10015193 177 / 2e-58 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10020661 138 / 7e-43 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10029881 136 / 2e-39 AT5G27830 245 / 9e-80 unknown protein
Lus10025446 50 / 7e-09 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2)
Lus10013180 51 / 2e-08 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1)
Lus10008142 49 / 3e-08 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Lus10015318 45 / 1e-06 AT1G28330 117 / 2e-35 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10013997 43 / 6e-06 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10015418 43 / 6e-06 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G014900 114 / 1e-33 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.005G024250 112 / 3e-33 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.003G070500 60 / 2e-12 AT1G54070 90 / 6e-24 Dormancy/auxin associated family protein (.1)
Potri.001G164800 53 / 1e-09 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
Potri.004G047100 47 / 3e-07 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05564 Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence
>Lus10031488 pacid=23155872 polypeptide=Lus10031488 locus=Lus10031488.g ID=Lus10031488.BGIv1.0 annot-version=v1.0
ATGAGTCTCCTCGACCAGCTGTGGGACGACACCGTCGCCGGACCAAGGCCTGACAGCGGCCTCGGCAAGCTCAGGAAGCACAGAACCTTCAGTTTCCGAA
CAGCCACCGGCAACGATTCCGATGGAGGCGGGAGCGTGAAATCGTACTCCGGCGGCGATGAAGCAGCAGCGCCAGAGGAATCCACGAGAGTGACACGCAG
TATCATGATAGTGAGGCCGCCGGGGTACCAGAGCGGATCTACTCCCCCGGTGTCTCCTGCCGGATCTACTCCTCCGGTGTCTCCATTTTCCGGAAGCAGC
AGAGGTTCATTCAGGTTCCGGAGAAGGTCAGCATCAGATGCAGAGGCGGCTGCTGCCACCGCTGCCGGAAGCCCAGTTGGACCAAGGAGCTCTTCTTCTC
CTTACGACGTTTGA
AA sequence
>Lus10031488 pacid=23155872 polypeptide=Lus10031488 locus=Lus10031488.g ID=Lus10031488.BGIv1.0 annot-version=v1.0
MSLLDQLWDDTVAGPRPDSGLGKLRKHRTFSFRTATGNDSDGGGSVKSYSGGDEAAAPEESTRVTRSIMIVRPPGYQSGSTPPVSPAGSTPPVSPFSGSS
RGSFRFRRRSASDAEAAAATAAGSPVGPRSSSSPYDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G56220 Dormancy/auxin associated fami... Lus10031488 0 1
AT1G80920 AtToc12, AtJ8, ... translocon at the outer envelo... Lus10041671 3.3 0.8872
AT5G28770 bZIP BZO2H3, ATBZIP6... Arabidopsis thaliana basic leu... Lus10006590 5.3 0.8439
AT5G28770 bZIP BZO2H3, ATBZIP6... Arabidopsis thaliana basic leu... Lus10015913 7.3 0.8463
AT5G56550 ATOXS3 oxidative stress 3 (.1) Lus10012939 7.3 0.8611
AT1G24160 unknown protein Lus10029213 7.5 0.8053
AT4G28570 Long-chain fatty alcohol dehyd... Lus10003621 7.7 0.8028
AT5G05090 GARP Homeodomain-like superfamily p... Lus10027291 8.5 0.8222
AT3G06350 EMB3004, MEE32 MATERNAL EFFECT EMBRYO ARREST ... Lus10004130 9.8 0.8226
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10009847 11.2 0.8412
AT3G01470 HD HD-ZIP-1, HAT5,... HOMEODOMAIN PROTEIN FROM ARABI... Lus10025232 15.2 0.8126

Lus10031488 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.